Phosducin Antibody - BSA Free

Western Blot: Phosducin Antibody [NBP2-85472] - Host: Rabbit. Target Name: PDC. Sample Tissue: Human HCT116 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Discontinued

Phosducin Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human Phosducin. Peptide sequence: KEILRQMSSPQSRNGKDSKERVSRKMSIQEYELIHKEKEDENCLRKYRRQ The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDC
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Phosducin Antibody - BSA Free

• 33 kDa phototransducing protein
• 33kDA phototransducing protein
• G beta gamma binding protein
• PHD
• PhLP
• phosducin
• phosducin-like orphan protein

Background

The Phosducin gene encodes a phosphoprotein, which is located in the outer and inner segments of the rod cells in the retina. This protein may participate in the regulation of visual phototransduction or in the integration of photoreceptor metabolism. It modulates

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PDC