PHKG2 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PHKG2. Source: E. coli Amino Acid Sequence: LTAEQALQHPFFERCEGSQPWNLTPRQRFRVAVWTVLAAGRVALSTHRVRPLTKNALLRDPYALRSVRHLIDNCAFRLY Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
PHKG2 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56609. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for PHKG2 Recombinant Protein Antigen
Background
PHKG2, also known as Phosphorylase b kinase gamma catalytic chain, liver/testis isoform, has 2 isoforms, a 406 amino acid long isoform that is 46 kDa and a short 374 amino acid isoform that is 43 kDa, as catalytic subunit of the phosphorylase b kinase (PHK) mediates the neural and hormonal regulation of glycogen breakdown (glycogenolysis) by phosphorylating and thereby activating glycogen phosphorylase and may regulate glycogeneolysis in the testis and phosphorylates PYGM in vitro. Studies on this protein have shown a relationship with the following diseases and disorders: glycogen storage disease, cirrhosis due to liver, phosphorylase kinase deficiency, hepatitis, metabolic disorders, hypotonia malaria, and alcoholism. This protein has interactions with PHKG1, UBE3A, PHKA2, PHKB, and PYGL in PKA signaling, cAMP Pathway, activation of cAMP-dependent PKA, alpha-adrenergic signaling, metabolism of carbohydrates, glycogen breakdown (glycogenolysis), glucose metabolism, calcium signaling pathway and insulin signaling pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu
Applications: ELISA, IHC, IP, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, IHC, WB
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: AC
Publications for PHKG2 Recombinant Protein Antigen (NBP2-56609PEP) (0)
There are no publications for PHKG2 Recombinant Protein Antigen (NBP2-56609PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PHKG2 Recombinant Protein Antigen (NBP2-56609PEP) (0)
There are no reviews for PHKG2 Recombinant Protein Antigen (NBP2-56609PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for PHKG2 Recombinant Protein Antigen (NBP2-56609PEP) (0)
Additional PHKG2 Products
Research Areas for PHKG2 Recombinant Protein Antigen (NBP2-56609PEP)
Find related products by research area.
|
Blogs on PHKG2