Recombinant Human PHF7 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PHF7 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 258-357 of Human PHF7 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GRDSFEDEGRWCLILCATCGSHGTHRDCSSLRSNSKKWECEECSPAAATDYIPENSGDIPCCSSTFHPEEHFCRDNTLEENPGLSWTDWPEPSLLEKPES

Protein/Peptide Type
Partial Recombinant Protein
Gene
PHF7

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PHF7 Protein

  • DKFZp434L1850
  • HSPC045
  • HSPC226
  • MGC26088
  • NYD-SP6
  • PHD finger protein 7
  • Testis development protein NYD-SP6

Background

Spermatogenesis is a complex process regulated by extracellular and intracellular factors as well as cellular interactions among interstitial cells of the testis, Sertoli cells, and germ cells. In the testis, this gene is expressed in Sertoli cells but not germ cells. However, this gene is not expressed in a patient who exhibited spermatogenic arrest at the spermatocyte stage. Spermatogenic arrest is an interruption of germ cell differentiation that may result in oligospermia or azoospermia. The proteins encoded by this gene contain plant homeodomain (PHD) finger domains, also known as leukemia associated protein (LAP) domains, believed to be involved in transcriptional regulation. Thus this protein, which localizes to the nucleus of transfected cells, has been implicated in the transcriptional regulation of spermatogenesis. Two protein isoforms are encoded by transcript variants of this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01086
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90117
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38302
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83493
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NBP1-82883
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76511
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-05048
Species: Hu, Mu, Rt, Bv, Ca, Sh
Applications: WB, ICC/IF
NBP2-22360
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-119
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBL1-11569
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-83534
Species: Hu
Applications: IHC, IHC-P
NBP2-33482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007516-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for PHF7 Partial Recombinant Protein (H00051533-Q01) (0)

There are no publications for PHF7 Partial Recombinant Protein (H00051533-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHF7 Partial Recombinant Protein (H00051533-Q01) (0)

There are no reviews for PHF7 Partial Recombinant Protein (H00051533-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PHF7 Partial Recombinant Protein (H00051533-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PHF7 Products

Bioinformatics Tool for PHF7 Partial Recombinant Protein (H00051533-Q01)

Discover related pathways, diseases and genes to PHF7 Partial Recombinant Protein (H00051533-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHF7 Partial Recombinant Protein (H00051533-Q01)

Discover more about diseases related to PHF7 Partial Recombinant Protein (H00051533-Q01).
 

Pathways for PHF7 Partial Recombinant Protein (H00051533-Q01)

View related products by pathway.

PTMs for PHF7 Partial Recombinant Protein (H00051533-Q01)

Learn more about PTMs related to PHF7 Partial Recombinant Protein (H00051533-Q01).

Blogs on PHF7

There are no specific blogs for PHF7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PHF7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PHF7