PHF1 Antibody (2A12)

Images

 
Western Blot: PHF1 Antibody (2A12) [H00005252-M03] - Analysis of PHF1 expression in K-562 (Cat # L009V1).
ELISA: PHF1 Antibody (2A12) [H00005252-M03] - Detection limit for recombinant GST tagged PHF1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2A12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PHF1 Antibody (2A12) Summary

Immunogen
PHF1 (NP_077084, 2 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVP
Specificity
PHF1 (2A12)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PHF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PHF1 Antibody (2A12)

  • hPCl1
  • MTF2L2
  • PCL1
  • PHD finger protein 1
  • PHF2
  • Polycomb-like protein 1
  • Protein PHF1

Background

This gene encodes a protein with significant sequence similarity to Drosophila Polycomblike. The encoded protein contains a zinc finger-like PHD (plant homeodomain) finger which is distinct from other classes of zinc finger motifs and which shows the typical Cys4-His-Cys3 arrangement. PHD finger genes are thought to belong to a diverse group of transcriptional regulators possibly affecting eukaryotic gene expression by influencing chromatin structure. Two transcript variants have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF6846
Species: Hu
Applications: IHC
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-45388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31758
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
44260002
Species: Hu
Applications: WB, ELISA
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
MAB4184
Species: Hu, Mu
Applications: WB, IP, ICC
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7250
Species: Hu
Applications: IHC
NBP2-57403
Species: Hu
Applications: WB, ICC/IF
NBP1-71865
Species: Hu
Applications: WB, IP, PLA
NBP2-29965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PHF1 Antibody (H00005252-M03) (0)

There are no publications for PHF1 Antibody (H00005252-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHF1 Antibody (H00005252-M03) (0)

There are no reviews for PHF1 Antibody (H00005252-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PHF1 Antibody (H00005252-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PHF1 Products

Bioinformatics Tool for PHF1 Antibody (H00005252-M03)

Discover related pathways, diseases and genes to PHF1 Antibody (H00005252-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHF1 Antibody (H00005252-M03)

Discover more about diseases related to PHF1 Antibody (H00005252-M03).
 

Pathways for PHF1 Antibody (H00005252-M03)

View related products by pathway.

PTMs for PHF1 Antibody (H00005252-M03)

Learn more about PTMs related to PHF1 Antibody (H00005252-M03).

Blogs on PHF1.

H3.1t - A testis-specific histone variant
Histones are nuclear proteins essential for the storage and organization of genomic DNA as chromatin. Chromatin consists of DNA wrapped tightly around histone oligomers to form nucleosomes. In addition to compacting the genome, histones also regula...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHF1 Antibody (2A12) and receive a gift card or discount.

Bioinformatics

Gene Symbol PHF1
Entrez
OMIM
Uniprot