PGM2L1 Antibody

Images

 
Western Blot: PGM2L1 Antibody [NBP2-31656] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Immunohistochemistry-Paraffin: PGM2L1 Antibody [NBP2-31656] - Staining of human cerebral cortex shows moderate nuclear and cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PGM2L1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YLETMNITLKQQLVKVYEKYGYHISKTSYFLCYEPPTIKSIFERLRNFDSPKEYPKFCGTFAILHVRDVTTGYD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PGM2L1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PGM2L1 Protein (NBP2-31656PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PGM2L1 Antibody

  • BM32Aglucose-1,6-bisphosphate synthase
  • EC 2.7.1
  • EC 2.7.1.106
  • FLJ32029
  • glucose 1,6-bisphosphate synthase
  • phosphoglucomutase 2-like 1
  • Phosphoglucomutase-2-like 1
  • PMMLP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32601
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57753
Species: Hu
Applications: WB, ICC/IF
NBP1-86064
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1481
Species: Hu
Applications: WB, PEP-ELISA
NBP2-13395
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12900
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57200
Species: Hu
Applications: ICC/IF
H00051444-T01
Species: Hu
NBP1-87098
Species: Hu
Applications: IHC, IHC-P
H00051444-T01
Species: Hu
H00004502-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for PGM2L1 Antibody (NBP2-31656) (0)

There are no publications for PGM2L1 Antibody (NBP2-31656).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGM2L1 Antibody (NBP2-31656) (0)

There are no reviews for PGM2L1 Antibody (NBP2-31656). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PGM2L1 Antibody (NBP2-31656) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PGM2L1 Products

Bioinformatics Tool for PGM2L1 Antibody (NBP2-31656)

Discover related pathways, diseases and genes to PGM2L1 Antibody (NBP2-31656). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGM2L1 Antibody (NBP2-31656)

Discover more about diseases related to PGM2L1 Antibody (NBP2-31656).
 

Pathways for PGM2L1 Antibody (NBP2-31656)

View related products by pathway.

Research Areas for PGM2L1 Antibody (NBP2-31656)

Find related products by research area.

Blogs on PGM2L1

There are no specific blogs for PGM2L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PGM2L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PGM2L1
Uniprot