New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

PGM2 Recombinant Protein Antigen

Images

 
There are currently no images for PGM2 Protein (NBP2-32601PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PGM2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PGM2.

Source: E.coli

Amino Acid Sequence: PHDKGISQAIEENLEPWPQAWDDSLIDSSPLLHNPSASINNDYFEDLKKYCFHRSVNRETKVKFVH

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PGM2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-32601.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for PGM2 Recombinant Protein Antigen

  • EC 5.4.2
  • EC 5.4.2.2
  • EC 5.4.2.7
  • FLJ10983
  • Glucose phosphomutase 2
  • PGM 2
  • Phosphodeoxyribomutase
  • phosphoglucomutase 2
  • phosphoglucomutase-2
  • Phosphopentomutase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005236-M01
Species: Bv, Hu
Applications: ELISA, ICC/IF, IP, KD, S-ELISA, WB
NBP2-45880
Species: Hu, Mu, Rt
Applications: IF, IHC, IHC-P, WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP2-66825
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15291
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-03734
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-87401
Species: Hu, Mu, Rt, RM
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-19015
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC-P, IP, Simple Western, WB
NB100-236
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-66881
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
2914-HT
Species: Hu
Applications: BA
AF5075
Species: Hu, Mu, Rt
Applications: WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP3-15868
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-03621
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-81923
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-89111
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for PGM2 Protein (NBP2-32601PEP) (0)

There are no publications for PGM2 Protein (NBP2-32601PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGM2 Protein (NBP2-32601PEP) (0)

There are no reviews for PGM2 Protein (NBP2-32601PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PGM2 Protein (NBP2-32601PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PGM2 Products

Bioinformatics Tool for PGM2 Protein (NBP2-32601PEP)

Discover related pathways, diseases and genes to PGM2 Protein (NBP2-32601PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGM2 Protein (NBP2-32601PEP)

Discover more about diseases related to PGM2 Protein (NBP2-32601PEP).
 

Pathways for PGM2 Protein (NBP2-32601PEP)

View related products by pathway.

PTMs for PGM2 Protein (NBP2-32601PEP)

Learn more about PTMs related to PGM2 Protein (NBP2-32601PEP).

Blogs on PGM2

There are no specific blogs for PGM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Holo-Transferrin
2914-HT-100MG

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PGM2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PGM2