New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Home » PGM2 » PGM2 Proteins » PGM2 Recombinant Protein Antigen

PGM2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PGM2 Protein (NBP2-32601PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

PGM2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PGM2.

Source: E.coli

Amino Acid Sequence: PHDKGISQAIEENLEPWPQAWDDSLIDSSPLLHNPSASINNDYFEDLKKYCFHRSVNRETKVKFVH
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PGM2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-32601.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for PGM2 Recombinant Protein Antigen

  • EC 5.4.2
  • EC 5.4.2.2
  • EC 5.4.2.7
  • FLJ10983
  • Glucose phosphomutase 2
  • PGM 2
  • Phosphodeoxyribomutase
  • phosphoglucomutase 2
  • phosphoglucomutase-2
  • Phosphopentomutase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PGM1 Antibody
(3B8-H4)
H00005236-M01
Western Blot: PGM1 Antibody (3B8-H4) [H00005236-M01] - Analysis of PGM1 expression in transfected 293T cell line by PGM1 monoclonal antibody (M01), clone 3B8-H4.Lane 1: PGM1 transfected lysate(61.4 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: PGM1 Antibody (3B8-H4) [H00005236-M01] - Analysis of monoclonal antibody to PGM1 on HeLa cell. Antibody concentration 20 ug/ml.
Immunoprecipitation: PGM1 Antibody (3B8-H4) [H00005236-M01] - Analysis of PGM1 transfected lysate using anti-PGM1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PGM1 MaxPab rabbit polyclonal antibody.
(2 Publications)
Species: Bv, Hu
Applications: ELISA, ICC/IF, IP, KD, S-ELISA, WB
PGD Antibody
(OTI2A5)
NBP2-45880
Immunofluorescence: PGD Antibody (OTI2A5) [NBP2-45880] - Analysis of COS7 cells transiently transfected by pCMV6-ENTRY PGD.
Immunohistochemistry-Paraffin: PGD Antibody (OTI2A5) [NBP2-45880] - Human pancreas tissue within the normal limits using anti-PGD mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100 degrees C for 10min.
Immunohistochemistry-Paraffin: PGD Antibody (OTI2A5) [NBP2-45880] - Carcinoma of Human prostate tissue using anti-PGD mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100 degrees C for 10min.
Species: Hu, Mu, Rt
Applications: IF, IHC, IHC-P, WB
Adenosine
Deaminase/ADA Antibod
NBP1-87404
Immunohistochemistry-Paraffin: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
ESD Antibody (J0-8)
NBP2-66825
Flow Cytometry: ESD Antibody (J0-8) [NBP2-66825] - Analysis of Jurkat cells with ESD antibody at 1/100 dilution (blue) compared with an unlabelled control (cells without incubation with primary antibody; red). Goat anti mouse IgG (FITC) was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: ESD Antibody (J0-8) [NBP2-66825] - Staining of Hela cells using anti-ESD Mouse mAb.
Immunocytochemistry/Immunofluorescence: ESD Antibody (J0-8) [NBP2-66825] - Staining of HepG2 cells using anti-ESD Mouse mAb.
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
ADK Antibody
NBP2-15291
Western Blot: ADK Antibody [NBP2-15291] - Rat tissue extracts (50 ug) was separated by 10 % SDS-PAGE, and the membrane was blotted with Adenosine kinase antibody diluted by 1:1500.
Western Blot: ADK Antibody [NBP2-15291] - Mouse tissue extracts (50 ug) was separated by 10 % SDS-PAGE, and the membrane was blotted with Adenosine kinase antibody diluted by 1:1500.
Immunohistochemistry-Paraffin: ADK Antibody [NBP2-15291] - Mouse kidney. Adenosine kinase antibody dilution: 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PHGDH Antibody
NBP1-87311
Western Blot: PHGDH Antibody [NBP1-87311] - Analysis: NBP1-87311 (A) shows similar pattern to independent antibody NBP1-87310 (B)
Simple Western: PHGDH Antibody [NBP1-87311] - Simple Western lane view shows a specific band for PHGDH in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311] - Immunohistochemical staining of human skeletal muscle shows no positivity as expected.
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
PGM3 Antibody
(OTI1A11)
NBP2-03734
Flow Cytometry: PGM3 Antibody (1A11) [NBP2-03734] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-PGM3 antibody, and then analyzed by flow cytometry.
Western Blot: PGM3 Antibody (1A11) [NBP2-03734] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PGM3 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PGM3.
Immunohistochemistry-Paraffin: PGM3 Antibody (1A11) [NBP2-03734] - Staining of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-PGM3 mouse monoclonal antibody.
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
Adenylate Kinase 1
Antibody
NBP1-87401
Immunocytochemistry/Immunofluorescence: Adenylate Kinase 1 Antibody [NBP1-87401] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Adenylate Kinase 1 Antibody [NBP1-87401] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: Adenylate Kinase 1 Antibody [NBP1-87401] - Staining in human fallopian tube and small intestine tissues using anti-AK1 antibody. Corresponding AK1 RNA-seq data are presented for the same tissues.
(1 Review)
Species: Hu, Mu, Rt, RM
Applications: ICC/IF, IHC, IHC-P, WB
Glyoxalase I
Antibody (Glo1a)
NBP1-19015
Simple Western: Glyoxalase I Antibody (Glo1a) [NBP1-19015] - Simple Western lane view shows a specific band for GLO1 in 0.5 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230kDa separation system. * Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
Western Blot: Glyoxalase I Antibody (Glo1a) [NBP1-19015] - HeLa whole cell extracts.
Immunocytochemistry/Immunofluorescence: Glyoxalase I Antibody (Glo1a) [NBP1-19015] - Immunostaining of human retinal endothelial cells. Immunoreactivity for hGlx-1 was detected in human retinal endothelial cells stained with Glo1a mAb using anti mouse IgG Texas Red as secondary Ab. The cells were counter stained with phalloidin (green) and DAPI (blue), nuclear stain. No reactivity was detected in control cells, stained without Go1a mAb. Figure is a representative of 3 independent experiments. Photo courtesy of Dr. Nagaraj, Case Western Reserve University.
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC-P, IP, Simple Western, WB
Glucose 6
Phosphate Dehydrogena ...
NB100-236
Immunoprecipitation: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Detection of mouse G6PD by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from NIH 3T3 cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-G6PD antibody NB100-236 (lot 2) used for IP at 6 ug per reaction. G6PD was also immunoprecipitated by a previous lot of this antibody (lot 1). For blotting immunoprecipitated G6PD, NB100-236 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Immunoblot analyses of protein expression for Nrf2 and antioxidant enzymes. Representative immunoblots of cytosolic extracts from the hearts of young and old mice under basal conditions and following EES. Protein blots were probed with anti-HO1, NQO1, GCLM, GCLC, Catalase, SOD1, SOD2, GSR, G6PD, GPX1 and GAPDH. Individual lanes indicate a single animal. Densitometry analysis of respective protein signals was performed using Image-J and expressed as relative intensity units calculated as mean values of young and old, *p<0.05. Individual lanes indicate each animal (n?=?6). #p<0.05-between basal and EES. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0045697), licensed under a CC-BY licence.
Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Detection of Human and Mouse G6PD by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-G6PD antibody NB100-236 used for WB at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(17 Publications)
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Human ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Bovine ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in FFPE human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.
(3 Reviews)
(11 Publications)
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Haptoglobin
Antibody (JM10-79)
NBP2-66881
Immunocytochemistry/Immunofluorescence: Haptoglobin Antibody (JM10-79) [NBP2-66881] - Staining Haptoglobin in A549 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Haptoglobin Antibody (JM10-79) [NBP2-66881] - Staining Haptoglobin in Hela cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Haptoglobin Antibody (JM10-79) [NBP2-66881] - Staining Haptoglobin in HepG2 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Holo-Transferrin
2914-HT
Holo-Transferrin
(4 Reviews)
(33 Publications)
Species: Hu
Applications: BA
LMW-PTP/ACP1
Antibody
AF5075
Western blot shows lysates of SH‑SY5Y human neuroblastoma cell line, human placenta tissue, TF‑1 human erythroleukemic cell line, C2C12 mouse myoblast cell line, and Rat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse/Rat LMW‑PTP/ACP1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5075) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for LMW‑PTP/ACP1 at approximately 18 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin was detected in immersion fixed BG01V human embryonic stem cells differentiated to hepatocytes using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. Cells were co-stained using Sheep Anti-Human CEBP alpha (Catalog # AF7094) and NorthernLights™ 493-conjugated Anti-Sheep IgG Secondary Antibody (green, Catalog # NL012). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Albumin was detected in immersion fixed paraffin-embedded sections of human liver using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 0.1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm and plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(5 Reviews)
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Ceruloplasmin
Antibody (6C3K9)
NBP3-15868
Immunohistochemistry-Paraffin: Ceruloplasmin Antibody (6C3K9) [NBP3-15868] - Immunohistochemistry of paraffin-embedded rat liver using Ceruloplasmin Rabbit mAb (NBP3-15868) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Ceruloplasmin Antibody (6C3K9) [NBP3-15868] - Immunohistochemistry of paraffin-embedded human liver using Ceruloplasmin Rabbit mAb (NBP3-15868) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry: Ceruloplasmin Antibody (6C3K9) [NBP3-15868] - Immunofluorescence analysis of rat liver using Ceruloplasmin Rabbit mAb (NBP3-15868) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
UBL4A Antibody
(OTI1D4)
NBP2-03621
Western Blot: UBL4A Antibody (1D4) [NBP2-03621] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY UBL4A (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-UBL4A.
Immunohistochemistry-Paraffin: UBL4A Antibody (1D4) [NBP2-03621] - Staining of paraffin-embedded Human liver tissue using anti-UBL4A mouse monoclonal antibody.
Immunocytochemistry/Immunofluorescence: UBL4A Antibody (1D4) [NBP2-03621] Staining of COS7 cells transiently transfected by pCMV6-ENTRY UBL4A.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DPAGT1 Antibody -
BSA Free
NBP2-81923
Western Blot: DPAGT1 Antibody [NBP2-81923] - Analysis of DPAGT1 in mouse kidney tissue lysate with DPAGT1 antibody at 1 ug/ml in (A) the absence and (B) the presence of blocking peptide.
Immunohistochemistry: DPAGT1 Antibody [NBP2-81923] - Analysis of DPAGT1 in human kidney tissue with DPAGT1 antibody at 2.5 ug/ml.
Immunocytochemistry/Immunofluorescence: DPAGT1 Antibody [NBP2-81923] - Analysis of DPAGT1 in human kidney tissue with DPAGT1 antibody at 20 ug/ml.
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
GPT Antibody
NBP1-89111
Western Blot: GPT Antibody [NBP1-89111] - Western blot analysis in mouse liver tissue and rat liver tissue.
Immunohistochemistry-Paraffin: GPT Antibody [NBP1-89111] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: GPT Antibody [NBP1-89111] - Staining of human tonsil shows low expression as expected.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Glucose 6
phosphate isomerase A ...
NBP2-02541
Western Blot: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Glucose 6 phosphate isomerase(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Glucose 6 phosphate isomerase.
Immunohistochemistry-Paraffin: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] - Staining of paraffin-embedded Adenocarcinoma of Human ovary tissue using anti-Glucose 6 phosphate isomerasemouse monoclonal antibody.
Immunohistochemistry-Paraffin: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] - Staining of paraffin-embedded Carcinoma of Human prostate tissue using anti-Glucose 6 phosphate isomerasemouse monoclonal antibody.
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for PGM2 Protein (NBP2-32601PEP) (0)

There are no publications for PGM2 Protein (NBP2-32601PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGM2 Protein (NBP2-32601PEP) (0)

There are no reviews for PGM2 Protein (NBP2-32601PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PGM2 Protein (NBP2-32601PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PGM2 Products

Bioinformatics Tool for PGM2 Protein (NBP2-32601PEP)

Discover related pathways, diseases and genes to PGM2 Protein (NBP2-32601PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGM2 Protein (NBP2-32601PEP)

Discover more about diseases related to PGM2 Protein (NBP2-32601PEP).
 

Pathways for PGM2 Protein (NBP2-32601PEP)

View related products by pathway.

PTMs for PGM2 Protein (NBP2-32601PEP)

Learn more about PTMs related to PGM2 Protein (NBP2-32601PEP).

Blogs on PGM2

There are no specific blogs for PGM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin Antibody (188835) [Unconjugated] - Serum
MAB1455
Holo-Transferrin
2914-HT-100MG

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PGM2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PGM2