PGLYRP4/PGRP-I beta Antibody - BSA Free

Western Blot: PGLYRP4/PGRP-I beta Antibody [NBP3-09527] - Western blot analysis of PGLYRP4/PGRP-I beta in 293T Whole Cell lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PGLYRP4/PGRP-I beta Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PGLYRP4/PGRP-I beta (NP_065126). Peptide sequence LGIQAWGDSSWNKTQAKQVSEGLQYLFENISQLTEKGLPTDVSTTVSRKA
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PGLYRP4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 39 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PGLYRP4/PGRP-I beta Antibody - BSA Free

• peptidoglycan recognition protein 4
• peptidoglycan recognition protein I beta
• Pglyrp-1 beta
• PGLYRP4
• PGRPI beta
• PGRP-I beta
• PGRP-I-beta

Background

The primary immune recognition is based on structures common among invading pathogens. Bacterial surface molecules, such as lipopolysaccharide (LPS) and peptidoglycan (PGN), are known to elicit immune reactions ranging from cytokine release to fever. Recently, a family of proteins called peptidoglycan recognition protein (PGRP) has been identified in mouse and human that binds to peptidoglycans expressed on Gram-positive bacteria. Peptidoglycan (PGN) is an essential cell wall component of virtually all bacteria (1,2) and, thus, it is an excellent target for recognition by the eukaryotic innate immune system. The PGRPs (PGRP-L, PGRP-S, PGRP-I alpha, and PGRP-I beta) define a new family of human pattern recognition molecules (3). PGRP-L is primarily expressed in the liver. Although liver is not considered a primary immune organ, liver participates in host defenses by producing acute phase proteins (by hepatocytes) in response to infections and by clearing microorganisms from blood (4-5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PGLYRP4