We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PGLYRP1/PGRP-S Recombinant Protein Antigen

Images

 
There are currently no images for PGLYRP1/PGRP-S Protein (NBP1-92261PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PGLYRP1/PGRP-S Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PGLYRP1.

Source: E. coli

Amino Acid Sequence: PMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PGLYRP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92261.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PGLYRP1/PGRP-S Recombinant Protein Antigen

  • peptidoglycan recognition protein 1
  • Peptidoglycan recognition protein short
  • PGLYRP
  • PGLYRP1
  • PGRPpeptidoglycan recognition protein
  • PGRPS
  • PGRP-S
  • PGRP-SMGC126894
  • PGRPSMGC126896
  • TAG7
  • TNF superfamily, member 3 (LTB)-like (peptidoglycan recognition protein)
  • TNFSF3L

Background

The primary immune recognition is based on structures common among invading pathogens. Bacterial surface molecules, such as lipopolysaccharide (LPS) and peptidoglycan (PGN), are known to elicit immune reactions ranging from cytokine release to fever. Recently, a family of proteins called peptidoglycan recognition protein (PGRP) has been identified in mouse and human that binds to peptidoglycans expressed on Gram-positive bacteria. Peptidoglycan (PGN) is an essential cell wall component of virtually all bacteria (1,2) and, thus, it is an excellent target for recognition by the eukaryotic innate immune system. The PGRPs (PGRP-L, PGRP-S, PGRP-Ia, and PGRP-Ib) define a new family of human pattern recognition molecules (3). PGRP-L is primarily expressed in the liver. Although liver is not considered a primary immune organ, liver participates in host defenses by producing acute phase proteins (by hepatocytes) in response to infections and by clearing microorganisms from blood (4). PGRP-S is present in neutrophils and inhibits growth of Gram-positive bacteria and, therefore, may function as a neutrophil antibacterial protein (5). However, PGRP-S may have another, as yet unidentified function because in humans it is expressed in the bone marrow 50

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01860
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-49690
Species: Hu, Mu
Applications: ICC/IF, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NB100-56729
Species: Hu
Applications: Flow-CS, Flow-IC, Flow, ICC/IF, WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-61118
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NB100-56721
Species: Hu
Applications: Flow-CS, Flow-IC, ICC/IF, WB
NB100-56722
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
H00006275-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-76733
Species: Hu
Applications: ELISA
NBP2-92897
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56152
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-91684
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP2-01168
Species: Hu, Pm, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB

Publications for PGLYRP1/PGRP-S Protein (NBP1-92261PEP) (0)

There are no publications for PGLYRP1/PGRP-S Protein (NBP1-92261PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGLYRP1/PGRP-S Protein (NBP1-92261PEP) (0)

There are no reviews for PGLYRP1/PGRP-S Protein (NBP1-92261PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PGLYRP1/PGRP-S Protein (NBP1-92261PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PGLYRP1/PGRP-S Products

Research Areas for PGLYRP1/PGRP-S Protein (NBP1-92261PEP)

Find related products by research area.

Blogs on PGLYRP1/PGRP-S

There are no specific blogs for PGLYRP1/PGRP-S, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PGLYRP1/PGRP-S Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PGLYRP1