PGBD3 Antibody


Western Blot: PGBD3 Antibody [NBP1-57117] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

PGBD3 Antibody Summary

Synthetic peptides corresponding to PGBD3(piggyBac transposable element derived 3) The peptide sequence was selected from the N terminal of PGBD3. Peptide sequence AESDSDDPSYAPKDDSPDEVPSTFTVQQPPPSRRRKMTKILCKWKKADLT.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PGBD3 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PGBD3 Antibody

  • FLJ90201
  • piggyBac transposable element derived 3
  • piggyBac transposable element-derived protein 3


The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. Anti-PGBD3 belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. Anti-PGBD3 overlaps with the ERCC6 gene on chromosome 10, and pseudogenes of this locus have been found on chromosomes 4, 5 and 12. The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene overlaps with the ERCC6 gene on chromosome 10, and pseudogenes of this locus have been found on chromosomes 4, 5 and 12.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PGBD3 Antibody (NBP1-57117) (0)

There are no publications for PGBD3 Antibody (NBP1-57117).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGBD3 Antibody (NBP1-57117) (0)

There are no reviews for PGBD3 Antibody (NBP1-57117). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PGBD3 Antibody (NBP1-57117) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for PGBD3 Antibody (NBP1-57117)

Discover related pathways, diseases and genes to PGBD3 Antibody (NBP1-57117). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGBD3 Antibody (NBP1-57117)

Discover more about diseases related to PGBD3 Antibody (NBP1-57117).

Pathways for PGBD3 Antibody (NBP1-57117)

View related products by pathway.

PTMs for PGBD3 Antibody (NBP1-57117)

Learn more about PTMs related to PGBD3 Antibody (NBP1-57117).

Blogs on PGBD3

There are no specific blogs for PGBD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PGBD3 Antibody and receive a gift card or discount.


Gene Symbol PGBD3