PGAP3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PGAP3 Antibody [NBP1-86692] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: PGAP3 Antibody [NBP1-86692] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PGAP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPIYMSLAGWTCRDDCKYECMWVTVGLYLQEGHKVPQFHGKWP
Specificity
Specificity of human PGAP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PGAP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PGAP3 Protein (NBP1-86692PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PGAP3 Antibody

  • AGLA546
  • CAB2COS16 homolog
  • Gene coamplified with ERBB2 protein
  • MGC9753hCOS16
  • PER1
  • per1-like domain containing 1
  • PERLD1PER1-like domain-containing protein 1
  • post-GPI attachment to proteins 3
  • post-GPI attachment to proteins factor 3
  • PP1498

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-125
Species: Hu
Applications: WB, ICC/IF
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NB100-126
Species: Hu, Mu
Applications: WB, ChIP
AF3764
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-86436
Species: Hu
Applications: IHC, IHC-P
NBP2-00749
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-1269
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1800
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IB, ICC/IF, IHC-P, IP
NBP1-31363
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6077
Species: Hu
Applications: WB

Publications for PGAP3 Antibody (NBP1-86692) (0)

There are no publications for PGAP3 Antibody (NBP1-86692).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGAP3 Antibody (NBP1-86692) (0)

There are no reviews for PGAP3 Antibody (NBP1-86692). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PGAP3 Antibody (NBP1-86692) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PGAP3 Antibody (NBP1-86692)

Discover related pathways, diseases and genes to PGAP3 Antibody (NBP1-86692). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGAP3 Antibody (NBP1-86692)

Discover more about diseases related to PGAP3 Antibody (NBP1-86692).
 

Pathways for PGAP3 Antibody (NBP1-86692)

View related products by pathway.

PTMs for PGAP3 Antibody (NBP1-86692)

Learn more about PTMs related to PGAP3 Antibody (NBP1-86692).

Blogs on PGAP3

There are no specific blogs for PGAP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PGAP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PGAP3