| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Rabbit PGAM5 Antibody - Azide and BSA Free (NBP2-93600) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 50-146 of human PGAM5 (NP_001164014.1). GARPGPGVWDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PGAM5 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Reviewed Applications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||
|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Yongkang Yang |
WB | 12/20/2023 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for PGAM5 Antibody (NBP2-93600)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PGAM5 |