Recombinant Human PFKFB2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PFKFB2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 505 of Human PFKFB2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYLTEENGQIAVFDATNTTRERRDMILNFAEQNSFKVFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMEDFLKRIECYKVTYRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKIVYYLMNIHVQPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEITDLKVWTSQLKRTIQTAESLGVPYEQWKILNEIDAGVCEEMTYAEIEKRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHTIFKLTPVAYGCKVETIKLNVEAVNTHRDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEGAD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
PFKFB2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PFKFB2 Protein

  • 6PF-2-K/Fru-2,6-P2ase 2
  • 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2
  • 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2
  • DKFZp781D2217
  • fructose-2,6-bisphosphatase, cardiac isozyme
  • MGC138308,6PF-2-K/Fru-2,6-P2ase heart-type isozyme
  • MGC138310
  • PFK/FBPase 2
  • PFK-2/FBPase-2
  • PFKFB, cardiac

Background

The protein encoded by this gene is involved in both the synthesis and degradation of fructose-2,6-bisphosphate, a regulatory molecule that controls glycolysis in eukaryotes. The encoded protein has a 6-phosphofructo-2-kinase activity that catalyzes the synthesis of fructose-2,6-bisphosphate, and a fructose-2,6-biphosphatase activity that catalyzes the degradation of fructose-2,6-bisphosphate. This protein regulates fructose-2,6-bisphosphate levels in the heart, while a related enzyme encoded by a different gene regulates fructose-2,6-bisphosphate levels in the liver and muscle. This enzyme functions as a homodimer. Two transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-87293
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005209-M08
Species: Hu
Applications: WB, ELISA, IP
H00005207-D01P
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-32538
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29464
Species: Hu, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-57033
Species: Hu
Applications: WB
H00004212-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-02272
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-85789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47219
Species: Hu
Applications: WB, PEP-ELISA
MAB2380
Species: Hu
Applications: WB

Publications for PFKFB2 Recombinant Protein (H00005208-P01) (0)

There are no publications for PFKFB2 Recombinant Protein (H00005208-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PFKFB2 Recombinant Protein (H00005208-P01) (0)

There are no reviews for PFKFB2 Recombinant Protein (H00005208-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PFKFB2 Recombinant Protein (H00005208-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PFKFB2 Products

Bioinformatics Tool for PFKFB2 Recombinant Protein (H00005208-P01)

Discover related pathways, diseases and genes to PFKFB2 Recombinant Protein (H00005208-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PFKFB2 Recombinant Protein (H00005208-P01)

Discover more about diseases related to PFKFB2 Recombinant Protein (H00005208-P01).
 

Pathways for PFKFB2 Recombinant Protein (H00005208-P01)

View related products by pathway.

PTMs for PFKFB2 Recombinant Protein (H00005208-P01)

Learn more about PTMs related to PFKFB2 Recombinant Protein (H00005208-P01).

Blogs on PFKFB2

There are no specific blogs for PFKFB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PFKFB2 Antibody
NBP2-33584

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PFKFB2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PFKFB2