PFKFB2 Antibody

Images

 
Western Blot: PFKFB2 Antibody [H00005208-B01P] - Analysis of PFKFB2 expression in transfected 293T cell line by PFKFB2 polyclonal antibody. Lane 1: PFKFB2 transfected lysate(55.55 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PFKFB2 Antibody Summary

Immunogen
PFKFB2 (NP_006203.2, 1 a.a. - 505 a.a.) full-length human protein. MSGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYLTEENGQIAVFDATNTTRERRDMILNFAEQNSFKVFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMEDFLKRIECYKVTYRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKIVYYLMNIHVQPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEITDLKVWTSQLKRTIQTAESLGVPYEQWKILNEIDAGVCEEMTYAEIEKRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHTIFKLTPVAYGCKVETIKLNVEAVNTHRDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEGAD
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PFKFB2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PFKFB2 Antibody

  • 6PF-2-K/Fru-2,6-P2ase 2
  • 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2
  • 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2
  • DKFZp781D2217
  • fructose-2,6-bisphosphatase, cardiac isozyme
  • MGC138308,6PF-2-K/Fru-2,6-P2ase heart-type isozyme
  • MGC138310
  • PFK/FBPase 2
  • PFK-2/FBPase-2
  • PFKFB, cardiac

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-87293
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005209-M08
Species: Hu
Applications: WB, ELISA, IP
H00005207-D01P
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-32538
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29464
Species: Hu, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-57033
Species: Hu
Applications: WB
H00004212-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-02272
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-85789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47219
Species: Hu
Applications: WB, PEP-ELISA
MAB2380
Species: Hu
Applications: WB

Publications for PFKFB2 Antibody (H00005208-B01P) (0)

There are no publications for PFKFB2 Antibody (H00005208-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PFKFB2 Antibody (H00005208-B01P) (0)

There are no reviews for PFKFB2 Antibody (H00005208-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PFKFB2 Antibody (H00005208-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PFKFB2 Products

Bioinformatics Tool for PFKFB2 Antibody (H00005208-B01P)

Discover related pathways, diseases and genes to PFKFB2 Antibody (H00005208-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PFKFB2 Antibody (H00005208-B01P)

Discover more about diseases related to PFKFB2 Antibody (H00005208-B01P).
 

Pathways for PFKFB2 Antibody (H00005208-B01P)

View related products by pathway.

PTMs for PFKFB2 Antibody (H00005208-B01P)

Learn more about PTMs related to PFKFB2 Antibody (H00005208-B01P).

Blogs on PFKFB2

There are no specific blogs for PFKFB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PFKFB2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PFKFB2
Uniprot