Recombinant Human PET112L Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PET112L Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 466 - 556 of Human PET112L partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SAAKQVFEELWKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKKLS

Protein/Peptide Type
Partial Recombinant Protein
Gene
PET112

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PET112L Protein

  • Cytochrome oxidase assembly factor PET112 homolog
  • EC 6.3.5
  • EC 6.3.5.-
  • Glu-ADT subunit B
  • mitochondrial
  • PET112 (yeast homolog)-like
  • PET112-like (yeast)

Background

PET112L - PET112-like (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-13640
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP1-88677
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91733
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59560
Species: Hu
Applications: WB, IHC, IHC-P
AF3795
Species: Hu
Applications: WB, IP
NBP1-86322
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001353-B02P
Species: Hu
Applications: WB, ICC/IF
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-89095
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30682
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85937
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-30388
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005188-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PET112L Partial Recombinant Protein (H00005188-Q01) (0)

There are no publications for PET112L Partial Recombinant Protein (H00005188-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PET112L Partial Recombinant Protein (H00005188-Q01) (0)

There are no reviews for PET112L Partial Recombinant Protein (H00005188-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PET112L Partial Recombinant Protein (H00005188-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PET112L Products

Bioinformatics Tool for PET112L Partial Recombinant Protein (H00005188-Q01)

Discover related pathways, diseases and genes to PET112L Partial Recombinant Protein (H00005188-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PET112L Partial Recombinant Protein (H00005188-Q01)

Discover more about diseases related to PET112L Partial Recombinant Protein (H00005188-Q01).
 

Pathways for PET112L Partial Recombinant Protein (H00005188-Q01)

View related products by pathway.

PTMs for PET112L Partial Recombinant Protein (H00005188-Q01)

Learn more about PTMs related to PET112L Partial Recombinant Protein (H00005188-Q01).

Blogs on PET112L

There are no specific blogs for PET112L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATM Antibody
NB100-104
PET112L Antibody
NBP1-80925
COX-2 Antibody
NB100-689

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PET112L Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PET112