Peroxiredoxin 5 Recombinant Protein Antigen

Images

 
There are currently no images for Peroxiredoxin 5 Protein (NBP2-38371PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Peroxiredoxin 5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRDX5.

Source: E.coli

Amino Acid Sequence: NKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKV

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRDX5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38371.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Peroxiredoxin 5 Recombinant Protein Antigen

  • ACR1
  • ACR1Peroxisomal antioxidant enzyme
  • Alu corepressor 1
  • Alu co-repressor 1
  • Antioxidant enzyme B166
  • AOEB166
  • AOEB166Peroxiredoxin V
  • AOPP
  • B166
  • EC 1.11.1.15
  • Liver tissue 2D-page spot 71B
  • MGC117264
  • MGC142283
  • MGC142285
  • Peroxiredoxin 5
  • peroxiredoxin-5, mitochondrial
  • PLPThioredoxin peroxidase PMP20
  • PMP20
  • PRDX5
  • PRDX6
  • PRXV
  • prx-V
  • SBBI10
  • Thioredoxin reductase
  • TPx type VI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Gp, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-88573
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52983
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1608
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-20619
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00004340-B01P
Species: Hu, Rt
Applications: WB
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
H00055697-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01863
Species: Hu
Applications: WB, IHC, IHC-P
MAB5765
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP2-46617
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Peroxiredoxin 5 Protein (NBP2-38371PEP) (0)

There are no publications for Peroxiredoxin 5 Protein (NBP2-38371PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Peroxiredoxin 5 Protein (NBP2-38371PEP) (0)

There are no reviews for Peroxiredoxin 5 Protein (NBP2-38371PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Peroxiredoxin 5 Protein (NBP2-38371PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Peroxiredoxin 5 Products

Bioinformatics Tool for Peroxiredoxin 5 Protein (NBP2-38371PEP)

Discover related pathways, diseases and genes to Peroxiredoxin 5 Protein (NBP2-38371PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Peroxiredoxin 5 Protein (NBP2-38371PEP)

Discover more about diseases related to Peroxiredoxin 5 Protein (NBP2-38371PEP).
 

Pathways for Peroxiredoxin 5 Protein (NBP2-38371PEP)

View related products by pathway.

PTMs for Peroxiredoxin 5 Protein (NBP2-38371PEP)

Learn more about PTMs related to Peroxiredoxin 5 Protein (NBP2-38371PEP).

Blogs on Peroxiredoxin 5

There are no specific blogs for Peroxiredoxin 5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Peroxiredoxin 5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDX5