Peroxiredoxin 5 Recombinant Protein Antigen

Images

 
There are currently no images for Peroxiredoxin 5 Protein (NBP2-38371PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Peroxiredoxin 5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRDX5.

Source: E. coli

Amino Acid Sequence: NKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRDX5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38371.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Peroxiredoxin 5 Recombinant Protein Antigen

  • ACR1
  • ACR1Peroxisomal antioxidant enzyme
  • Alu corepressor 1
  • Alu co-repressor 1
  • Antioxidant enzyme B166
  • AOEB166
  • AOEB166Peroxiredoxin V
  • AOPP
  • B166
  • EC 1.11.1.15
  • Liver tissue 2D-page spot 71B
  • MGC117264
  • MGC142283
  • MGC142285
  • Peroxiredoxin 5
  • peroxiredoxin-5, mitochondrial
  • PLPThioredoxin peroxidase PMP20
  • PMP20
  • PRDX5
  • PRDX6
  • PRXV
  • prx-V
  • SBBI10
  • Thioredoxin reductase
  • TPx type VI

Background

Peroxiredoxin 5 encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution. This gene uses alternate in-frame translation initiation sites to generate mitochondrial or peroxisomal/cytoplasmic forms. Three transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-717
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, RIA, RI, WB
AF2307
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NBP3-04784
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-87781
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
MAB7428
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: EM, IHC,  IHC-P, WB
AF2439
Species: Mu
Applications: IHC, WB
538-MG
Species: Rt
Applications: BA
NBP1-86919
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-45606
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB100-92243
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PLA, WB
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-01863
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF3254
Species: Hu, Mu, Rt
Applications: WB
NBP2-46617
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC

Publications for Peroxiredoxin 5 Protein (NBP2-38371PEP) (0)

There are no publications for Peroxiredoxin 5 Protein (NBP2-38371PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Peroxiredoxin 5 Protein (NBP2-38371PEP) (0)

There are no reviews for Peroxiredoxin 5 Protein (NBP2-38371PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Peroxiredoxin 5 Protein (NBP2-38371PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Peroxiredoxin 5 Products

Research Areas for Peroxiredoxin 5 Protein (NBP2-38371PEP)

Find related products by research area.

Blogs on Peroxiredoxin 5

There are no specific blogs for Peroxiredoxin 5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Peroxiredoxin 5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDX5