Peroxiredoxin 3 Antibody

Images

 
Western Blot: Peroxiredoxin 3 Antibody [NBP1-53060] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Immunocytochemistry/ Immunofluorescence: Peroxiredoxin 3 Antibody [NBP1-53060] - Formalin Fixed Paraffin; Embedded Tissue: Human Bronchial Epithelial Tissue; Observed Staining: Cytoplasmic; Primary Antibody ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Peroxiredoxin 3 Antibody Summary

Immunogen
Synthetic peptides corresponding to PRDX3(peroxiredoxin 3) The peptide sequence was selected from the N terminal of PRDX3. Peptide sequence AIPWGISATAALRPAACGRTSLTNLLCSGSSQAPYFKGTAVVNGEFKDLS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRDX3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against PRDX3 and was validated on Western blot.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Peroxiredoxin 3 Antibody

  • Antioxidant protein 1MGC104387
  • AOP-1
  • AOP-1MGC24293
  • AOP1PRO1748
  • EC 1.11.1.15
  • HBC189
  • MER5
  • Peroxiredoxin 3
  • Peroxiredoxin III
  • peroxiredoxin-3
  • PRDX3
  • Protein MER5 homolog
  • prx-III
  • SP-22
  • thioredoxin-dependent peroxide reductase, mitochondrial

Background

PRDX3 is a protein with antioxidant function and is localized in the mitochondrion. Expression of this gene product in E. coli deficient in the C22-subunit gene rescued resistance of the bacteria to alkylhydroperoxide. The human and mouse genes are highly conserved, and they map to the regions syntenic between mouse and human chromosomes. Sequence comparisons with recently cloned mammalian homologues suggest that these genes consist of a family that is responsible for regulation of cellular proliferation, differentiation, and antioxidant functions. This gene encodes a protein with antioxidant function and is localized in the mitochondrion. This gene shows significant nucleotide sequence similarity to the gene coding for the C22 subunit of Salmonella typhimurium alkylhydroperoxide reductase. Expression of this gene product in E. coli deficient in the C22-subunit gene rescued resistance of the bacteria to alkylhydroperoxide. The human and mouse genes are highly conserved, and they map to the regions syntenic between mouse and human chromosomes. Sequence comparisons with recently cloned mammalian homologues suggest that these genes consist of a family that is responsible for regulation of cellular proliferation, differentiation, and antioxidant functions. Two transcript variants encoding two different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3254
Species: Hu, Mu, Rt
Applications: WB
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00055697-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-02117
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB300-864
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1992
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Gt, GP, Ha, Mk, Rb, Sh, Sq, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-81272
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-53060
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for Peroxiredoxin 3 Antibody (NBP1-53060) (0)

There are no publications for Peroxiredoxin 3 Antibody (NBP1-53060).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Peroxiredoxin 3 Antibody (NBP1-53060) (0)

There are no reviews for Peroxiredoxin 3 Antibody (NBP1-53060). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Peroxiredoxin 3 Antibody (NBP1-53060) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Peroxiredoxin 3 Products

Bioinformatics Tool for Peroxiredoxin 3 Antibody (NBP1-53060)

Discover related pathways, diseases and genes to Peroxiredoxin 3 Antibody (NBP1-53060). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Peroxiredoxin 3 Antibody (NBP1-53060)

Discover more about diseases related to Peroxiredoxin 3 Antibody (NBP1-53060).
 

Pathways for Peroxiredoxin 3 Antibody (NBP1-53060)

View related products by pathway.

PTMs for Peroxiredoxin 3 Antibody (NBP1-53060)

Learn more about PTMs related to Peroxiredoxin 3 Antibody (NBP1-53060).
 

Research Areas for Peroxiredoxin 3 Antibody (NBP1-53060)

Find related products by research area.

Blogs on Peroxiredoxin 3

There are no specific blogs for Peroxiredoxin 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Peroxiredoxin 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDX3
Entrez