Periaxin Antibody - Azide and BSA Free

Western Blot: Periaxin Antibody [NBP2-93522] - Analysis of extracts of various cell lines, using Periaxin at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 30s.

Immunocytochemistry/Immunofluorescence: Periaxin Antibody [NBP2-93522] - Analysis of U-2 OS cells using Periaxin at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Periaxin Antibody - Azide and BSA Free [NBP2-93522] - Immunofluorescence analysis of C6 cells using Periaxin Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Periaxin Antibody - Azide and BSA Free [NBP2-93522] - Immunofluorescence analysis of L929 cells using Periaxin Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Periaxin Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit Periaxin Antibody - Azide and BSA Free (NBP2-93522) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1250-1350 of human PRX (NP_870998.2). LGARARVGGEGAEEQPPGAERTFCLSLPDVELSPSGGNHAEYQVAEGEGEAGHKLKVRLPRFGLVRAKEGAEEGEKAKSPKLRLPRVGFSQSEMVTGEGSP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRX
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for Periaxin Antibody - Azide and BSA Free

• CMT4F
• PRX

Background

Periaxin is involved in peripheral nerve myelin upkeep. The encoded protein contains 2 PDZ domains which were named after PSD95 (post synaptic density protein), DlgA (Drosophila disc large tumor suppressor), and ZO1 (a mammalian tight junction protein). Two alternatively spliced transcript variants have been described for this gene which encode different protein isoforms and which are targeted differently in the Schwann cell. Mutations in this gene cause Charcot-Marie-Tooth neuoropathy, type 4F and Dejerine-Sottas neuropathy. [provided by RefSeq, Jul 2008]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: PRX