PER2 Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Rabbit PER2 Antibody - Azide and BSA Free (NBP2-94634) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 390-565 of human PER2 (NP_073728.1). GQPFDYSPIRFRARNGEYITLDTSWSSFINPWSRKISFIIGRHKVRVGPLNEDVFAAHPCTEEKALHPSIQELTEQIHRLLLQPVPHSGSSGYGSLGSNGSHEHLMSQTSSSDSNGHEDSRRRRAEICKNGNKTKNRSHYSHESGEQKKKSVTEMQTNPPAEKKAVPAMEKDSLGV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PER2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.05% Proclin 300 |
| Purity |
Affinity purified |
Alternate Names for PER2 Antibody - Azide and BSA Free
Background
PER2 is a member of the Period protein family and a mammalian homolog of the Drosphilia period gene. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. Strong PER2 expression in the suprachiasmatic nuclei of the mamalian brain indicates that the PER gene functions in the circadian clock with PER2 being a component of the circadian oscillator. PER2 shares a 40% homology with PER1 including the protein dimerization PAS domain.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: DB, ELISA, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ChIP, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Mu
Applications: IHC
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Rt
Applications: WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for PER2 Antibody (NBP2-94634) (0)
There are no publications for PER2 Antibody (NBP2-94634).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PER2 Antibody (NBP2-94634) (0)
There are no reviews for PER2 Antibody (NBP2-94634).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PER2 Antibody (NBP2-94634) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PER2 Products
Research Areas for PER2 Antibody (NBP2-94634)
Find related products by research area.
|
Blogs on PER2