PEG3 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit PEG3 Antibody - BSA Free (NBP2-85455) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of human PEG3. Peptide sequence: FGECSGYIERASTSTGGANQADEKYFKCDVCGQLFNDRLSLARHQNTHTG The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PEG3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for PEG3 Antibody - BSA Free
Background
In human, ZIM2 and PEG3 are treated as two distinct genes though they share multiple 5' exons and a common promoter and both genes are paternally expressed (PMID:15203203). Alternative splicing events connect their shared 5' exons either with the remaining 4 exons unique to ZIM2, or with the remaining 2 exons unique to PEG3. In contrast, in other mammals ZIM2 does not undergo imprinting and, in mouse, cow, and likely other mammals as well, the ZIM2 and PEG3 genes do not share exons. Human PEG3 protein belongs to the Kruppel C2H2-type zinc finger protein family. PEG3 may play a role in cell proliferation and p53-mediated apoptosis. PEG3 has also shown tumor suppressor activity and tumorigenesis in glioma and ovarian cells. Alternative splicing of this PEG3 gene results in multiple transcript variants encoding distinct isoforms. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Bv, Hu, Mu, Pm, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: WB
Publications for PEG3 Antibody (NBP2-85455) (0)
There are no publications for PEG3 Antibody (NBP2-85455).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PEG3 Antibody (NBP2-85455) (0)
There are no reviews for PEG3 Antibody (NBP2-85455).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PEG3 Antibody (NBP2-85455) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PEG3 Products
Research Areas for PEG3 Antibody (NBP2-85455)
Find related products by research area.
|
Blogs on PEG3