PEG10 Recombinant Protein Antigen

Images

 
There are currently no images for PEG10 Recombinant Protein Antigen (NBP2-48592PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PEG10 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PEG10.

Source: E. coli

Amino Acid Sequence: LVDPHIEMIPGAHSIPSGHVYSLSEPEMAALRDFVARNVKDGLITPTIAPNGAQVLQVKRGWKLQVSYDCRAPNNFTIQNQYPR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PEG10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48592.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PEG10 Recombinant Protein Antigen

  • EDR
  • embryonal carcinoma differentiation regulated
  • Embryonal carcinoma differentiation-regulated protein
  • HB-1
  • KIAA1051EDR
  • Mammalian retrotransposon-derived protein 2
  • Mar2
  • Mart2
  • MEF3 Like 1
  • MEF3L
  • MEF3L1
  • Myelin expression factor 3-like protein 1
  • paternally expressed 10
  • Paternally expressed gene 10 protein
  • PEG10
  • retrotransposon gag domain containing 3
  • Retrotransposon gag domain-containing protein 3
  • Retrotransposon-derived gag-like polyprotein
  • retrotransposon-derived protein PEG10
  • RGAG3
  • RGAG3MEF3-like protein 1
  • RTL2
  • SIRH1
  • Ty3/Gypsy-like protein

Background

paternally expressed 10. This gene includes two overlapping reading frames of the same transcript encoding distinct isoforms. The shorter isoform has a CCHC-type zinc finger motif containing a sequence characteristic of gag proteins of most retroviruses and some retrotransposons, and it functions in part by interacting with members of the TGF-beta receptor family. The longer isoform has the active-site DSG consensus sequence of the protease domain of pol proteins. The longer isoform is the result of -1 translational frame shifting that is also seen in some retroviruses. Expression of these two isoforms only comes from the paternal allele due to imprinting. Increased gene expression (as observed by an increase in mRNA levels) is associated with hepatocellular carcinomas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr,  IHC-P, WB
292-G2
Species: Hu
Applications: BA
NBP1-59794
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, WB
NBP1-87299
Species: Hu
Applications: ICC/IF, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-46379
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-84008
Species: Hu
Applications: IHC,  IHC-P
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NB100-86989
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP1-76919
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF1396
Species: Hu
Applications: WB
NBP1-32914
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
4308-SE
Species: Hu
Applications: EnzAct
NB300-514
Species: Bv, Hu, Mu, Pm, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, WB

Publications for PEG10 Recombinant Protein Antigen (NBP2-48592PEP) (0)

There are no publications for PEG10 Recombinant Protein Antigen (NBP2-48592PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEG10 Recombinant Protein Antigen (NBP2-48592PEP) (0)

There are no reviews for PEG10 Recombinant Protein Antigen (NBP2-48592PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PEG10 Recombinant Protein Antigen (NBP2-48592PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PEG10 Products

Blogs on PEG10

There are no specific blogs for PEG10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PEG10 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PEG10