PEAR1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PEAR1 Antibody [NBP1-90449] - Immunofluorescent staining of human cell line U-2 OS shows localization to centrosome.
Immunohistochemistry: PEAR1 Antibody [NBP1-90449] - Staining of human bone marrow shows strong positivity in megakaryocytes and platelets.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P, IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PEAR1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PSDPNTCSFWESFTTTTKESHSRPFSLLPSEPCERPWEGPHTCPQPTVVYRTVYRQVVKTDHRQRLQCCHGFYES
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PEAR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Immunofluorescence
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PEAR1 Protein (NBP1-90449PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PEAR1 Antibody

  • Jedi
  • PEAR1
  • platelet endothelial aggregation receptor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-76941
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NB300-817
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP1-84127
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87076
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28457
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1642
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for PEAR1 Antibody (NBP1-90449) (0)

There are no publications for PEAR1 Antibody (NBP1-90449).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEAR1 Antibody (NBP1-90449) (0)

There are no reviews for PEAR1 Antibody (NBP1-90449). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PEAR1 Antibody (NBP1-90449) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PEAR1 Products

Bioinformatics Tool for PEAR1 Antibody (NBP1-90449)

Discover related pathways, diseases and genes to PEAR1 Antibody (NBP1-90449). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEAR1 Antibody (NBP1-90449)

Discover more about diseases related to PEAR1 Antibody (NBP1-90449).
 

Pathways for PEAR1 Antibody (NBP1-90449)

View related products by pathway.

PTMs for PEAR1 Antibody (NBP1-90449)

Learn more about PTMs related to PEAR1 Antibody (NBP1-90449).

Blogs on PEAR1

There are no specific blogs for PEAR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PEAR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PEAR1
Entrez