PEAR1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PEAR1 Antibody [NBP1-90449] - Immunofluorescent staining of human cell line U-2 OS shows localization to centrosome.

Immunohistochemistry-Paraffin: PEAR1 Antibody [NBP1-90449] - Staining of human skin shows no positivity in squamous epithelial cells as expected.

Immunohistochemistry-Paraffin: PEAR1 Antibody [NBP1-90449] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: PEAR1 Antibody [NBP1-90449] - Staining of human lung shows strong cytoplasmic positivity in macrophages.

Immunohistochemistry-Paraffin: PEAR1 Antibody [NBP1-90449] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.

Staining of human skin shows no positivity in squamous epithelial cells as expected.

Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PEAR1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PSDPNTCSFWESFTTTTKESHSRPFSLLPSEPCERPWEGPHTCPQPTVVYRTVYRQVVKTDHRQRLQCCHGFYES
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PEAR1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PEAR1 Protein (NBP1-90449PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PEAR1 Antibody - BSA Free

• Jedi
• PEAR1
• platelet endothelial aggregation receptor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PEAR1