Recombinant Human PDK2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PDK2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 187 - 276 of Human PDK2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:HIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPIKVM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PDK2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PDK2 Protein

  • EC 2.7.11
  • EC 2.7.11.2
  • lipoamide, kinase isozyme 2, mitochondrial
  • Pyruvate dehydrogenase kinase isoform 2
  • pyruvate dehydrogenase kinase, isoenzyme 2
  • pyruvate dehydrogenase kinase, isozyme 2

Background

PDK2 - pyruvate dehydrogenase kinase, isoenzyme 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-07047
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-2383
Species: Hu
Applications: WB, ICC/IF
MAB864
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-82432
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56992
Species: Hu
Applications: IHC-P
NBP1-88347
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32581
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-80104
Species: Hu
Applications: WB
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PDK2 Partial Recombinant Protein (H00005164-Q01) (0)

There are no publications for PDK2 Partial Recombinant Protein (H00005164-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDK2 Partial Recombinant Protein (H00005164-Q01) (0)

There are no reviews for PDK2 Partial Recombinant Protein (H00005164-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDK2 Partial Recombinant Protein (H00005164-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PDK2 Products

Bioinformatics Tool for PDK2 Partial Recombinant Protein (H00005164-Q01)

Discover related pathways, diseases and genes to PDK2 Partial Recombinant Protein (H00005164-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDK2 Partial Recombinant Protein (H00005164-Q01)

Discover more about diseases related to PDK2 Partial Recombinant Protein (H00005164-Q01).
 

Pathways for PDK2 Partial Recombinant Protein (H00005164-Q01)

View related products by pathway.

PTMs for PDK2 Partial Recombinant Protein (H00005164-Q01)

Learn more about PTMs related to PDK2 Partial Recombinant Protein (H00005164-Q01).
 

Research Areas for PDK2 Partial Recombinant Protein (H00005164-Q01)

Find related products by research area.

Blogs on PDK2

There are no specific blogs for PDK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PDK2 Antibody
NBP1-87307

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PDK2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PDK2