PDE1A Antibody - BSA Free

Western Blot: PDE1A Antibody [NBP3-35143] - Western blot analysis of various lysates using PDE1A Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

• Reactivity: Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PDE1A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PDE1A Antibody - BSA Free (NBP3-35143) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 446-545 of human PDE1A (NP_005010.2).
  
  Sequence:
  EASKAETSSYVASSSTTIVGLHIADALRRSNTKGSMSDGSYSPDYSLAAVDLKSFKNNLVDIIQQNKERWKELAAQGESDLHKNSEDLVNAEEKHDETHS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDE1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 61 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PDE1A Antibody - BSA Free

• 3'-5' cyclic nucleotide phosphodiesterase
• 61 kDa Cam-PDE
• calcium/calmodulin-dependent 3'-5'-cyclic nucleotide phosphodiesterase 1A
• calcium/calmodulin-stimulated cyclic nucleotide phosphodiesterase
• calmodulin-dependent phosphodiesterase
• Cam-PDE 1A
• EC 3.1.4
• EC 3.1.4.17
• HCAM1
• hCam-1
• HSPDE1A
• MGC26303
• PDE1A
• phosphodiesterase 1A, calmodulin-dependent
• phosphodiesterase-1A

Background

PDE1A, a variant of PDE1, is a Ca2+-calmodulin-stimulated phosphodieterase (PDE) preferentially hydrolyzing cGMP. Cyclic nucleotides are hydrolyzed and compartmentalized by a family of enzymes called phosphodieterases. In mammals at least 11 different families of PDEs can be discriminated (PDE1-11) based on their kinetic properties and inhibition to various pharmacological agents. Three different PDE1 genes have been identified (PDE1A, B, and C). PDE1A and PDE1B have higher affinity for cGMP than for cAMP, whereas PDE1C has high affinity for both cAMP and cGMP. The PDE1A gene family includes various proteins that differ from each other at amino and carboxy termini of the protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PDE1A