PDCD7 Antibody (8A1Q3)

Western Blot: PDCD7 Antibody (8A1Q3) [NBP3-15482] - Western blot analysis of extracts of various cell lines, using PDCD7 antibody (NBP3-15482) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Western Blot: PDCD7 Antibody (8A1Q3) [NBP3-15482] - Western blot analysis of extracts of Rat brain, using PDCD7 antibody (NBP3-15482) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Immunohistochemistry: PDCD7 Antibody (8A1Q3) [NBP3-15482] - Immunohistochemistry analysis of PDCD7 in paraffin-embedded human breast tissue using PDCD7 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: PDCD7 Antibody (8A1Q3) [NBP3-15482] - Immunohistochemistry analysis of PDCD7 in paraffin-embedded human small intestine tissue using PDCD7 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: PDCD7 Antibody (8A1Q3) [NBP3-15482] - Immunohistochemistry analysis of PDCD7 in paraffin-embedded human esophagus tissue using PDCD7 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: PDCD7 Antibody (8A1Q3) [NBP3-15482] - Immunohistochemistry analysis of PDCD7 in paraffin-embedded mouse intestin tissue using PDCD7 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: PDCD7 Antibody (8A1Q3) [NBP3-15482] - Immunohistochemistry analysis of PDCD7 in paraffin-embedded human breast cancer tissue using PDCD7 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: PDCD7 Antibody (8A1Q3) [NBP3-15482] - Immunohistochemistry analysis of PDCD7 in paraffin-embedded rat liver tissue using PDCD7 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 8A1Q3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PDCD7 Antibody (8A1Q3) Summary

• Description: Novus Biologicals Rabbit PDCD7 Antibody (8A1Q3) (NBP3-15482) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PDCD7 (Q8N8D1). MALPPFFGQGRPGPPPPQPPPPAPFGCPPPPLPSPAFPPPLPQRPGPFPGASAPFLQPPLALQPRASAEASRGGGGAGAFYPVPPPPLPPPPPQCRPFPG
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PDCD7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PDCD7 Antibody (8A1Q3)

• apoptosis-related protein ES18
• ES18programmed cell death protein 7
• FLJ54213
• HES18
• MGC22015
• programmed cell death 7
• U11/U12 snRNP 59K

Background

PDCD7 encodes a protein with sequence similarity to a mouse protein originally identified in embryonic stem cells. In mouse T-cell lines, this protein appears to be related to glucocorticoid- and staurine-induced apoptotic pathways, and to be linked to ceramide-mediated signalling. These observations suggest that this gene product is involved in specific apoptotic processes in T-cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PDCD7