PDCD11 Antibody

Images

 
Immunohistochemistry: PDCD11 Antibody [NBP1-89141] - Staining of human kidney shows strong cytoplasmic and nucleolar positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDCD11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LTGPHKLEEGEVAMGRVVKVTPNEGLTVSFPFGKIGTVSIFHMSDSYSETPLEDFVPQKVVRCYILSTADNVLTLSLRSSRTNPETKSKVEDPEINSIQDIKEGQLLRGYVGSIQPHG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDCD11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PDCD11 Protein (NBP1-89141PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDCD11 Antibody

  • ALG-4
  • apoptosis-linked gene 4
  • KIAA0185NF-kappa-B-binding protein
  • NFBPALG4
  • programmed cell death 11
  • Programmed cell death protein 11
  • protein RRP5 homolog
  • RRP5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

126-FL/CF
Species: Hu
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00493
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
MAB2520
Species: Mu
Applications: WB, IHC, IP
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-233
Species: Hu
Applications: WB, PLA
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-89141
Species: Hu
Applications: IHC, IHC-P

Publications for PDCD11 Antibody (NBP1-89141) (0)

There are no publications for PDCD11 Antibody (NBP1-89141).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDCD11 Antibody (NBP1-89141) (0)

There are no reviews for PDCD11 Antibody (NBP1-89141). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PDCD11 Antibody (NBP1-89141) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDCD11 Products

Bioinformatics Tool for PDCD11 Antibody (NBP1-89141)

Discover related pathways, diseases and genes to PDCD11 Antibody (NBP1-89141). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDCD11 Antibody (NBP1-89141)

Discover more about diseases related to PDCD11 Antibody (NBP1-89141).
 

Pathways for PDCD11 Antibody (NBP1-89141)

View related products by pathway.

PTMs for PDCD11 Antibody (NBP1-89141)

Learn more about PTMs related to PDCD11 Antibody (NBP1-89141).

Blogs on PDCD11

There are no specific blogs for PDCD11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDCD11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDCD11