| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse PCTP Antibody - Azide and BSA Free (H00058488-B01P) is a polyclonal antibody validated for use in WB. Anti-PCTP Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | PCTP (AAH12084.1, 1 a.a. - 214 a.a.) full-length human protein. MELAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSMPQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNYLKKT |
| Specificity | PCTP - phosphatidylcholine transfer protein, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | PCTP |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against recombinant protein with GST tag on ELISA and western blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
| Publication using H00058488-B01P | Applications | Species |
|---|---|---|
| Li B, Vachali P, Frederick JM, Bernstein PS. Identification of StARD3 as a Lutein-binding Protein in the Macula of the Primate Retina. Biochemistry;50(13):2541-9. 2011-04-05 [PMID: 21322544] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PCTP |
| Entrez |
|
| Uniprot |
|