PCTAIRE3 Antibody

Immunocytochemistry/Immunofluorescence: PCTAIRE3 Antibody [NBP1-92249] - Staining of human cell line MCF7 shows localization to actin filaments. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PCTAIRE3 Antibody [NBP1-92249] - Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: PCTAIRE3 Antibody [NBP1-92249] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PCTAIRE3 Antibody [NBP1-92249] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in glial cells.

Immunohistochemistry-Paraffin: PCTAIRE3 Antibody [NBP1-92249] - Staining of human seminal vesicle shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PCTAIRE3 Antibody [NBP1-92249] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.

Product Discontinued

PCTAIRE3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MNKMKNFKRRFSLSVPRTETIEESLAEFTEQFNQLHNRRNENLQLGPLGRDPPQECSTFSPTDSGEEPGQLSPGVQFQRRQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDK18
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PCTAIRE3 Antibody

• CDK18
• Cell division protein kinase 18
• cyclin-dependent kinase 18
• EC 2.7.11
• EC 2.7.11.22
• PCTAIRE
• PCTAIRE3
• PCTAIRE-motif protein kinase 3
• PCTK3
• PCTK3PCTAIRE protein kinase 3
• Serine/threonine-protein kinase PCTAIRE-3

Background

PCTK3( AAH11526, 1 a.a. - 473 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDK18