PCTAIRE2 Antibody - BSA Free

Western Blot: PCTAIRE2 Antibody [NBP2-85452] - Host: Rabbit. Target Name: CDK17. Sample Type: 293T Whole cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PCTAIRE2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PCTAIRE2. Peptide sequence: RSLGPRIHALPESVSIFSLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDK17
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PCTAIRE2 Antibody - BSA Free

• CDK17
• Cell division protein kinase 17
• cyclin-dependent kinase 17
• EC 2.7.11
• EC 2.7.11.22
• PCTAIRE protein kinase 2
• PCTAIRE2
• PCTAIRE-motif protein kinase 2
• PCTK2
• protein kinase cdc2-related PCTAIRE-2
• Serine/threonine-protein kinase PCTAIRE-2

Background

PCTAIRE2 is encoded by this gene belongs to the cdc2/cdkx subfamily of the ser/thr family of protein kinases. It has similarity to rat protein which is thought to play a role in terminally differentiated neurons.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDK17