PCAF Recombinant Protein Antigen

Images

 
There are currently no images for PCAF Recombinant Protein Antigen (NBP2-58285PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PCAF Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PCAF.

Source: E. coli

Amino Acid Sequence: KFSHLPAKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KAT2B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58285.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PCAF Recombinant Protein Antigen

  • CREBBP-associated factor
  • EC 2.3.1.48
  • GCN5
  • GCN5L
  • Histone acetylase PCAF
  • histone acetyltransferase KAT2B
  • Histone acetyltransferase PCAF
  • K(lysine) acetyltransferase 2B
  • KAT2B
  • Lysine acetyltransferase 2B
  • P
  • P/CAFGCN5
  • P300/CBP-associated factorCAF
  • PCAF

Background

CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB
NB500-487
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-76729
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP3-09392
Species: Hu, Mu
Applications: WB
2695-SE
Species: Hu
Applications: EnzAct
NBP3-37988
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-93603
Species: Hu, Mu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB200-310
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NBP1-90364
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB

Publications for PCAF Recombinant Protein Antigen (NBP2-58285PEP) (0)

There are no publications for PCAF Recombinant Protein Antigen (NBP2-58285PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCAF Recombinant Protein Antigen (NBP2-58285PEP) (0)

There are no reviews for PCAF Recombinant Protein Antigen (NBP2-58285PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PCAF Recombinant Protein Antigen (NBP2-58285PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PCAF Products

Research Areas for PCAF Recombinant Protein Antigen (NBP2-58285PEP)

Find related products by research area.

Blogs on PCAF

There are no specific blogs for PCAF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PCAF Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KAT2B