Reactivity | HuSpecies Glossary |
Applications | WB, ICC/IF |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ALNGTILDPLDQWQPSGSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSL |
Specificity | Specificity of human Paxillin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | PXN |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
Control |
|
||
Control Peptide |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for Paxillin Antibody (NBP2-57097)Discover more about diseases related to Paxillin Antibody (NBP2-57097).
| Pathways for Paxillin Antibody (NBP2-57097)View related products by pathway.
|
PTMs for Paxillin Antibody (NBP2-57097)Learn more about PTMs related to Paxillin Antibody (NBP2-57097).
| Research Areas for Paxillin Antibody (NBP2-57097)Find related products by research area.
|
Autophagy and Metastasis By Christina Towers, PhD The majority of cancer patients die from metastatic disease at secondary sites. The threshold to undergo metastasis is high. Only a minority of cancer cells acquire invasive phenotypes... Read full blog post. |
CRISPR/Cas9: Keep your friends close, but your viruses closer "CRISPR", or clustered regularly interspaced short palindromic repeats, is an ancient bacterial mechanism that prevents the invasion of foreign pathogens to a host organism. Specifically, the CRISPR sequence has been identified as a si... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | PXN |