PAX9 Antibody

Western Blot: PAX9 Antibody [NBP1-89481] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Immunohistochemistry-Paraffin: PAX9 Antibody [NBP1-89481] - Staining in human parathyroid gland and pancreas tissues using anti-PAX9 antibody. Corresponding PAX9 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PAX9 Antibody [NBP1-89481] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: PAX9 Antibody [NBP1-89481] - Staining of human parathyroid gland shows high expression.

Product Discontinued

PAX9 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YGQAPNGLPAVGSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAGHGWQHAGGTSLSPHNCDIPASLAFKGMQAAREGSHSVTAS
• Predicted Species: Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PAX9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PAX9 Antibody

• paired box 9
• paired box gene 9
• paired box protein Pax-9
• paired domain gene 9
• Pax9
• STHAG3

Background

The PAX9 gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and c

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PAX9