Patched 2/PTCH2 Antibody - BSA Free

Western Blot: Patched 2 Antibody [NBP1-59457] - Human Placenta lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Patched 2/PTCH2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PTCH2(patched homolog 2 (Drosophila)) The peptide sequence was selected from the N terminal of PTCH2. Peptide sequence LAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTCH2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Patched 2/PTCH2 Antibody - BSA Free

• patched (Drosophila) homolog 2
• Patched 2
• patched homolog 2 (Drosophila)
• patched homolog 2
• protein patched homolog 2
• ptc2
• PTCH2

Background

PTCH2 is a member of the patched protein family. The patched protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis. The gene encoding PTCH2 is shown to be mutated in a medulloblastoma and in a basal cell carcinoma, suggesting that it plays a role in the development of some tumors. This gene encodes a member of the patched gene family. The patched protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis. This gene is shown to be mutated in a medulloblastoma and in a basal cell carcinoma, suggesting that it plays a role in the development of some tumors. Alternative transcript variants have been described, but their biological function has not been determined. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-10 AF119569.1 1-10 11-534 AY359016.1 3-526 535-2066 AF087651.1 523-2054 2067-2509 AF119569.1 2067-2509 2510-2520 AF087651.1 2498-2508 2521-2700 AF119569.1 2521-2700 2701-3620 AY358555.1 2689-3608 3621-3624 AF087651.1 3609-3612

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PTCH2
• Uniprot:
  • Q9Y6C5()