PASD1 Antibody (2B10)

Images

 
Western Blot: PASD1 Antibody (2B10) [H00139135-M04] - Analysis of PASD1 expression in Hela S3 NE (Cat # L013V3).
Sandwich ELISA: PASD1 Antibody (2B10) [H00139135-M04] - Detection limit for recombinant GST tagged PASD1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2B10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PASD1 Antibody (2B10) Summary

Immunogen
PASD1 (NP_775764, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKMRGEKRRDKVNPKSSQRKLNWIPSFPTYDYFNQVTLQLLDGFMITLSTDGVIICVAENISSLLGHLPAEIVGKKLLSLLPDEEKDEVYQKIILKFPLL
Specificity
PASD1 - PAS domain containing 1 (2B10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PASD1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PASD1 Antibody (2B10)

  • CT63Cancer/testis antigen 63
  • OXTES1
  • OX-TES-1
  • PAS domain containing 1
  • PAS domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003845-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
NBP1-83810
Species: Hu
Applications: IHC, IHC-P
NB100-124
Species: Hu, Mu, Rt, Bv, Ma, Pm, Sh
Applications: WB, ChIP, GS, IB, ICC/IF, IHC, IHC-P, IP, CHIP-SEQ
MAB5018
Species: Hu
Applications: WB, IP
NBP1-03285
Species: Hu, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF5525
Species: Hu
Applications: WB, IHC
NBP1-85419
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47396
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-67717
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-64775
Species: Hu, Mu, Pm, Bv, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, CyTOF-ready, IHC-P (-)
NB100-97821
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP
NBP2-59786
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008398-D01P
Species: Hu, Mu
Applications: WB
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-14921
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90614
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2864
Species: Hu
Applications: WB, ICC
H00139135-M04
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for PASD1 Antibody (H00139135-M04) (0)

There are no publications for PASD1 Antibody (H00139135-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PASD1 Antibody (H00139135-M04) (0)

There are no reviews for PASD1 Antibody (H00139135-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PASD1 Antibody (H00139135-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PASD1 Products

Bioinformatics Tool for PASD1 Antibody (H00139135-M04)

Discover related pathways, diseases and genes to PASD1 Antibody (H00139135-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PASD1 Antibody (H00139135-M04)

Discover more about diseases related to PASD1 Antibody (H00139135-M04).
 

Pathways for PASD1 Antibody (H00139135-M04)

View related products by pathway.

Blogs on PASD1

There are no specific blogs for PASD1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PASD1 Antibody (2B10) and receive a gift card or discount.

Bioinformatics

Gene Symbol PASD1
Entrez
Uniprot