Home » PASD1 » PASD1 Antibodies » PASD1 Antibody (2B10)

PASD1 Antibody (2B10)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: PASD1 Antibody (2B10) [H00139135-M04] - Analysis of PASD1 expression in Hela S3 NE (Cat # L013V3).
Western Blot: PASD1 Antibody (2B10) [H00139135-M04] - Analysis of PASD1 expression in Hela S3 NE (Cat # L013V3).
Sandwich ELISA: PASD1 Antibody (2B10) [H00139135-M04] - Detection limit for recombinant GST tagged PASD1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2B10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PASD1 Antibody (2B10) Summary

Immunogen
PASD1 (NP_775764, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKMRGEKRRDKVNPKSSQRKLNWIPSFPTYDYFNQVTLQLLDGFMITLSTDGVIICVAENISSLLGHLPAEIVGKKLLSLLPDEEKDEVYQKIILKFPLL
Specificity
PASD1 - PAS domain containing 1 (2B10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PASD1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PASD1 Antibody (2B10)

  • CT63Cancer/testis antigen 63
  • OXTES1
  • OX-TES-1
  • PAS domain containing 1
  • PAS domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

KRAS Antibody
(3B10-2F2)
H00003845-M01
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western blot analysis of KRAS expression in lysates from human lung cancer cell lines: H23, H358, A549, and H441. Image from verified customer review.
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western Blot analysis of KRAS expression in transfected 293T cell line by KRAS monoclonal antibody (M01), clone 3B10-2F2.Lane 1: KRAS transfected lysate(21 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: KRAS Antibody (3B10-2F2) [H00003845-M01] - Analysis of monoclonal antibody to KRAS on HeLa cell. Antibody concentration 10 ug/ml.
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
CASC1 Antibody
NBP1-83810
Immunohistochemistry-Paraffin: CASC1 Antibody [NBP1-83810] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: CASC1 Antibody [NBP1-83810] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts
Immunohistochemistry-Paraffin: CASC1 Antibody [NBP1-83810] - Staining of human fallopian tube shows high expression.
Species: Hu
Applications: IHC, IHC-P
ARNT/HIF-1 beta
Antibody (H1beta234)
NB100-124
Western Blot: ARNT/HIF-1 beta Antibody (H1beta234) [NB100-124] - Western Blot analysis with ARNT/HIF-1 beta antibody (H1beta234) [NB100-124], theoretical molecular weight 86.6 kDa. Expression of CD44 mRNA in genetically engineered MDA-MB-231 cells. (A) Immunoblot analysis of HIF-1A or HIF-2A expression in whole cell extracts from MDA-MB-231 cells stably expressing EV, HIF-1A-shRNA or HIF-2A-shRNA under normoxia or in response to 4 h treatment with 200 uM CoCl2. HIF-1B expression was used as a loading control. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0044078) licensed under a CC-BY licence.
Western Blot: ARNT/HIF-1 beta Antibody (H1beta234) [NB100-124] - HIF was not the only factor stabilizing activated EGFR in VHL-deficient ccRCC cells. A. Western blot analysis of 786-VHL and 786-mock cells stably expressing shRNA constructs. For HIF2A (NB100-480) and ARNT/HIF-1 beta antibody (H1beta234)[NB100-124] analysis, nuclear extracts were generated and analyzed. Anti-HA blot detected HA-VHL. Means and SDs of three separate experiments were shown. Theoretical molecular weight for ARNT/HIF-1 beta is 86.6 kDa, observed molecular weight ~90 kDa. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0023936) licensed under a CC-BY licence.
Immunohistochemistry: ARNT/HIF-1 beta Antibody (H1beta234) [NB100-124] - Staining of human glioblastoma multi-forme utilizing ARNT/HIF-1 beta antibody (H1beta234) [NB100-124].
(2 Reviews)
(96 Publications)
Species: Hu, Mu, Rt, Bv, Ma, Pm, Sh
Applications: WB, ChIP, GS, IB, ICC/IF, IHC, IHC-P, IP, CHIP-SEQ
PLA2G1B Antibody
(630823)
MAB5018
Western blot shows lysates of human pancreas tissue. PVDF Membrane was probed with 2 µg/mL of Human PLA2G1B Monoclonal Antibody (Catalog # MAB5018) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for PLA2G1B at approximately 17 kDa (as indicated). This experiment was conducted under non-reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB, IP
SPANXC Antibody
NBP1-03285
Western Blot: SPANXC Antibody [NBP1-03285] - Affinity purified anti-SPANX (pan) antibody shows detection of a band at ~17 kD corresponding to SPANX-C present in a nuclear extract from VWM105 cells (left panel, arrowhead). VWM105 cells are derived from a human melanoma and are positive for SPANX proteins. Lane 2 shows reactivity with a purified recombinant SPANX-C fusion protein. The right panel shows similar reactivity with purified recombinant SPANX-B, SPANX-C and SPANX-N proteins. Proteins were separated by SDS-PAGE, transferred to nitrocellulose, and probed with the primary antibody diluted to 1:1000. IRDye800 conjugated Gt-a-Rabbit IgG [H&L] MX ( was used (left). IRDye is a trademark of LI-COR, Inc. Size estimation was made by comparison to prestained MW markers as indicated. Personal Communication. Vladimir Larionov, NIH, CCR, Bethesda, MD.
Immunohistochemistry-Paraffin: SPANXC Antibody [NBP1-03285] - Staining of human testis. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Hu, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
IRF4 Antibody
AF5525
Western blot shows lysates of Ramos human Burkitt's lymphoma cell line, Raji human Burkitt's lymphoma cell line, and RPMI 8226 human multiple myeloma cell line. PVDF membrane was probed with 0.5 µg/mL of Sheep Anti-Human IRF4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5525) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for IRF4 at approximately 53 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
IRF4 was detected in immersion fixed paraffin-embedded sections of human tonsil using Sheep Anti-Human IRF4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5525) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm of lymphocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, IHC
Recombinant Human
DDX53 GST (N-Term) Pr ...
H00168400-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
(1 Publication)
Species: Hu
DDX43 Antibody
NBP1-85419
Western Blot: DDX43 Antibody [NBP1-85419] - Analysis in human cell line CAPAN-2.
Immunohistochemistry-Paraffin: DDX43 Antibody [NBP1-85419] - Staining in human testis and endometrium tissues using anti-DDX43 antibody. Corresponding DDX43 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DDX43 Antibody [NBP1-85419] - Staining of human endometrium shows low expression as expected.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
MUM1 Antibody
(4G10)
NBP1-47396
Western Blot: MUM1 Antibody (4G10) [NBP1-47396] - Western blot analysis using MUM1 mouse mAb against recombinant fragment of human MUM1.
Immunohistochemistry: MUM1 Antibody (4G10) [NBP1-47396] - Immunohistochemical analysis of paraffin-embedded human Uterus tissues using MUM1 mouse mAb
Immunohistochemistry: MUM1 Antibody (4G10) [NBP1-47396] - Immunohistochemical analysis of paraffin-embedded human melanoma (A), non-Hodgkin`s lymphoma (B), using MUM1 mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Neprilysin/CD10
Antibody (SN75-07)
NBP2-67717
Western Blot: Neprilysin/CD10 Antibody (SN75-07) [NBP2-67717] - Analysis of CD10 on Daudi cell lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature.
Immunocytochemistry/Immunofluorescence: Neprilysin/CD10 Antibody (SN75-07) [NBP2-67717] - Staining CD10 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody (SN75-07) [NBP2-67717] - Analysis of paraffin-embedded human tonsil tissue using anti-CD10 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
HLA ABC Antibody
(W6/32)
NB100-64775
Flow Cytometry: HLA ABC Antibody (W6/32) [NB100-64775] - Analysis using the FITC conjugate of NB100-64775. Staining of normal human peripheral blood cells with Mouse IgG2a K Isotype Control FITC (NBP1-43955) (blue histogram) or Anti-Human HLA-ABC FITC (purple histogram). Cells in the lymphocyte gate were used f
Flow Cytometry: HLA ABC Antibody (W6/32) [NB100-64775] - Staining of human peripheral blood lymphocytes with Mouse anti Human HLA ABC.
Flow Cytometry: HLA ABC Antibody (W6/32) [NB100-64775] - Staining of human peripheral blood lymphocytes with Mouse anti Human HLA ABC:Alexa Fluor 488.
(1 Review)
(24 Publications)
Species: Hu, Mu, Pm, Bv, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, CyTOF-ready, IHC-P (-)
Lysine
(K)-specific Demethyl ...
NB100-97821
Western Blot: Lysine (K)-specific Demethylase 5B/KDM5B/JARID1B Antibody [NB100-97821] - Whole cell lysate (50 ug) from HeLa, 293T, and Jurkat cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-JARID1B antibody used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunohistochemistry-Paraffin: Lysine (K)-specific Demethylase 5B/KDM5B/JARID1B Antibody [NB100-97821] - MCF-7 cells stained with Lysine (K)-specific Demethylase 5B antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: Lysine (K)-specific Demethylase 5B/KDM5B/JARID1B Antibody [NB100-97821] - Section of human prostate carcinoma. Antibody: Rabbit anti-JARID1B antibody used at 1:500 (2ug/ml). Secondary: HRP-conjugated goat anti-rabbit IgG (A120-501P). Substrate: DAB.
(1 Review)
(8 Publications)
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP
Bcl-6 Antibody
NBP2-59786
Immunocytochemistry/Immunofluorescence: Bcl-6 Antibody [NBP2-59786] - Human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Staining of human lymphoma, non-Hodgkin's type, shows strong nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Human tonsil shows strong nuclear positivity in germinal center cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PLA2G6 Antibody
H00008398-D01P
Western Blot: PLA2G6 Antibody [H00008398-D01P] - Analysis of PLA2G6 expression in mouse kidney.
Western Blot: PLA2G6 Antibody [H00008398-D01P] - Analysis of PLA2G6 expression in human kidney.
Western Blot: PLA2G6 Antibody [H00008398-D01P] - Analysis of PLA2G6 expression in transfected 293T cell line by PLA2G6 polyclonal antibody.Lane 1: PLA2G6 transfected lysate(84.10 KDa).Lane 2: Non-transfected lysate.
Species: Hu, Mu
Applications: WB
14-3-3 zeta
Antibody (818515) [Un ...
MAB2669
Western blot shows lysates of SH‑SY5Y human neuroblastoma cell line,SK‑Mel‑28 human malignant melanoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, and C6 rat glioma cell line. PVDF membrane was probed with 0.2 µg/mL of Mouse Anti-Human14‑3‑3 zeta  Monoclonal Antibody (Catalog # MAB2669) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for14‑3‑3 zeta at approximately 27 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of SH‑SY5Y human neuroblastoma cell line, loaded at 0.5 mg/mL. A specific band was detected for 14‑3‑3 zeta at approximately 34 kDa (as indicated) using 2 µg/mL of Mouse Anti-Human 14‑3‑3 zeta Monoclonal Antibody (Catalog # MAB2669). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
14‑3‑3 zeta  was detected in immersion fixed paraffin-embedded sections of human squamous cell carcinoma using Mouse Anti-Human 14‑3‑3 zeta Monoclonal Antibody (Catalog # MAB2669) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter­stained with hematoxylin (blue). Specific staining was localized to nuclei and plasma membrane. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
Species: Hu
Applications: WB, Simple Western, IHC
CTAGE1 Antibody
NBP2-14921
Western Blot: CTAGE1 Antibody [NBP2-14921] - Sample (30 ug of whole cell lysate) A: NT2D1 7.5% SDS PAGE; antibody diluted at 1:1000.
Immunohistochemistry-Paraffin: CTAGE1 Antibody [NBP2-14921] - Paraffin-embedded Colon ca, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, IHC, IHC-P
ODF3 Antibody
NBP1-90614
Western Blot: ODF3 Antibody [NBP1-90614] - Analysis in control (vector only transfected HEK293T lysate) and ODF3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: ODF3 Antibody [NBP1-90614] - Staining of human epididymis.
Immunohistochemistry-Paraffin: ODF3 Antibody [NBP1-90614] - Staining of human endometrium shows low expression as expected.
Species: Hu
Applications: WB, IHC, IHC-P
SPATA19 Antibody
NBP2-31979
Immunohistochemistry-Paraffin: SPATA19 Antibody [NBP2-31979] - Staining in human testis and endometrium tissues using anti-SPATA19 antibody. Corresponding SPATA19 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SPATA19 Antibody [NBP2-31979] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: SPATA19 Antibody [NBP2-31979] - Staining of human testis shows high expression.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
SOX10 Antibody
[Unconjugated]
AF2864
SOX10 was detected in immersion fixed BG01V human embryonic stem cells differentiated to neural crest stem cells using Goat Anti-Human SOX10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2864) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(8 Reviews)
(26 Publications)
Species: Hu
Applications: WB, ICC
PASD1 Antibody
(2B10)
H00139135-M04
PASD1 Antibody (2B10)
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for PASD1 Antibody (H00139135-M04) (0)

There are no publications for PASD1 Antibody (H00139135-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PASD1 Antibody (H00139135-M04) (0)

There are no reviews for PASD1 Antibody (H00139135-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PASD1 Antibody (H00139135-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional PASD1 Products

Bioinformatics Tool for PASD1 Antibody (H00139135-M04)

Discover related pathways, diseases and genes to PASD1 Antibody (H00139135-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PASD1 Antibody (H00139135-M04)

Discover more about diseases related to PASD1 Antibody (H00139135-M04).
 

Pathways for PASD1 Antibody (H00139135-M04)

View related products by pathway.

Blogs on PASD1

There are no specific blogs for PASD1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PASD1 Antibody (2B10) and receive a gift card or discount.


Bioinformatics

Gene Symbol PASD1
Entrez
Uniprot