PARP12 Antibody

Images

 
Western Blot: PARP12 Antibody [NBP2-88014] - Host: Rabbit. Target Name: PARP12. Sample Type: Ovary Tumor lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, Rt, Ca, EqSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PARP12 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human PARP12. Peptide sequence: PTIYRNAHDIKNKSSAPSRVPPLFVPQGTSERKDSSGSVSPNTLSQEEGD The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (100%), Canine (100%), Equine (91%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
PARP12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PARP12 Antibody

  • EC 2.4.2.30
  • FLJ22693MST109
  • PARP-12
  • poly (ADP-ribose) polymerase family, member 12
  • poly [ADP-ribose] polymerase 12
  • ZC3H1
  • ZC3HDC1MSTP109
  • Zinc finger CCCH domain-containing protein 1
  • zinc finger CCCH type domain containing 1
  • zinc finger CCCH-type domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-186
Species: Hu
Applications: WB, ICC/IF
NBP2-20940
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-05330
Species: Hu
NBP1-55053
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
DDX0390P-100
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, B/N, IHC-FrFl
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
NBP1-88831
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-43728
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB600-893
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88466
Species: Hu, Xp
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF2045
Species: Hu
Applications: WB, IHC, ICC
NBP1-91244
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31713
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81843
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-27419
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-88014
Species: Hu, Rt, Ca, Eq
Applications: WB

Publications for PARP12 Antibody (NBP2-88014) (0)

There are no publications for PARP12 Antibody (NBP2-88014).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARP12 Antibody (NBP2-88014) (0)

There are no reviews for PARP12 Antibody (NBP2-88014). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PARP12 Antibody (NBP2-88014) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PARP12 Products

Bioinformatics Tool for PARP12 Antibody (NBP2-88014)

Discover related pathways, diseases and genes to PARP12 Antibody (NBP2-88014). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARP12 Antibody (NBP2-88014)

Discover more about diseases related to PARP12 Antibody (NBP2-88014).
 

Pathways for PARP12 Antibody (NBP2-88014)

View related products by pathway.

Research Areas for PARP12 Antibody (NBP2-88014)

Find related products by research area.

Blogs on PARP12

There are no specific blogs for PARP12, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PARP12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PARP12