Recombinant Human PARD3B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PARD3B Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 101 - 209 of Human ALS2CR19 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SPDAFETEVAAQLAAFKPIGGEIEVTPSALKLGTPLLVRRSSDPVPGPPADTQPSASHPGGQSLKLVVPDSTQNLEDREVLNGVQTELLTSPRTKDTLSDMTRTVEISG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PARD3B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PARD3B Protein

  • ALS2CR19
  • amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 19
  • Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 19 protein
  • MGC16131
  • par-3 partitioning defective 3 homolog B (C. elegans)
  • PAR3B
  • PAR3beta
  • PAR3-beta
  • PAR3-L protein
  • PAR3L
  • Par3Lb
  • PAR3LC
  • partitioning defective 3 homolog B
  • Partitioning defective 3-like protein
  • partitioning-defective 3-beta

Background

ALS2CR19 - amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 19

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88861
Species: Hu, Mu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NLS261
Species: Hu
Applications: WB (-), IHC-P, ICC
NBP2-38487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-53125
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
AF567
Species: Mu, Rt
Applications: WB, Simple Western, IHC, Block
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-56902
Species: Hu
Applications: WB, ICC/IF
MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-12499
Species: Hu
Applications: IHC, IHC-P
NBP2-49153
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90980
Species: Hu
Applications: IHC, IHC-P
NBP1-03020
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84161
Species: Hu
Applications: IHC, IHC-P
H00117583-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PARD3B Partial Recombinant Protein (H00117583-Q01) (0)

There are no publications for PARD3B Partial Recombinant Protein (H00117583-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARD3B Partial Recombinant Protein (H00117583-Q01) (0)

There are no reviews for PARD3B Partial Recombinant Protein (H00117583-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PARD3B Partial Recombinant Protein (H00117583-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PARD3B Products

Bioinformatics Tool for PARD3B Partial Recombinant Protein (H00117583-Q01)

Discover related pathways, diseases and genes to PARD3B Partial Recombinant Protein (H00117583-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARD3B Partial Recombinant Protein (H00117583-Q01)

Discover more about diseases related to PARD3B Partial Recombinant Protein (H00117583-Q01).
 

Pathways for PARD3B Partial Recombinant Protein (H00117583-Q01)

View related products by pathway.

PTMs for PARD3B Partial Recombinant Protein (H00117583-Q01)

Learn more about PTMs related to PARD3B Partial Recombinant Protein (H00117583-Q01).
 

Research Areas for PARD3B Partial Recombinant Protein (H00117583-Q01)

Find related products by research area.

Blogs on PARD3B

There are no specific blogs for PARD3B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PARD3B Antibody
NBP1-89114

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PARD3B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PARD3B