Recombinant Human PARC Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PARC Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 918-1025 of Human PARC

Source: Wheat Germ

Amino Acid Sequence: MMLLNRYSEPPGSPERAALETPIIQGQDGSPELLIRSLVGGPSAELLLDLERVLCREGSPGGAVRPLLKRLQQETQPFLLLLRTLDAPGPNKTLLLSVLRVITRLLDF

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CUL9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PARC Protein

  • CUL-9
  • cullin 9
  • cullin-9
  • DKFZp686G1042
  • H7AP1DKFZp686P2024
  • p53-associated parkin-like cytoplasmic protein
  • PARCKIAA0708
  • parkin-like cytoplasmic p53 binding protein
  • RP3-330M21.2
  • UbcH7-associated protein 1

Background

PARC - p53-associated parkin-like cytoplasmic protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86928
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
7270-IL/CF
Species: Hu
NBP2-61816
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7446
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46198
Species: Hu
Applications: WB, IHC
NBP2-41266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-695
Species: Hu, Av, Bv, Fi, Ma, Re
Applications: WB, ELISA, IHC
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)

Publications for PARC Partial Recombinant Protein (H00023113-Q01) (0)

There are no publications for PARC Partial Recombinant Protein (H00023113-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARC Partial Recombinant Protein (H00023113-Q01) (0)

There are no reviews for PARC Partial Recombinant Protein (H00023113-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PARC Partial Recombinant Protein (H00023113-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for PARC Partial Recombinant Protein (H00023113-Q01)

Discover related pathways, diseases and genes to PARC Partial Recombinant Protein (H00023113-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARC Partial Recombinant Protein (H00023113-Q01)

Discover more about diseases related to PARC Partial Recombinant Protein (H00023113-Q01).

Research Areas for PARC Partial Recombinant Protein (H00023113-Q01)

Find related products by research area.

Blogs on PARC

There are no specific blogs for PARC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PARC Antibody
NBP1-77222
IL-6 [Unconjugated]
7270-IL-025/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PARC Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CUL9