Parathyroid hormone 2 Antibody

Images

 
Western Blot: parathyroid hormone 2 Antibody [NBP1-69679] - This Anti-PTH2 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Parathyroid hormone 2 Antibody Summary

Immunogen
Synthetic peptides corresponding to PTH2(parathyroid hormone 2) The peptide sequence was selected from the middle region of PTH2. Peptide sequence WADPATPRPRRSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PTH2 and was validated on Western blot.
Theoretical MW
11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Parathyroid hormone 2 Antibody

  • parathyroid hormone 2TIP39tuberoinfundibular 39 residue protein
  • TIPF39
  • tuberoinfundibular 39 residues
  • tuberoinfundibular peptide of 39 residues

Background

TIP39 is related to parathyroid hormone (PTH) and PTH-related protein (PTHRP) and is a ligand for PTH receptor-2.TIP39 is related to parathyroid hormone (PTH; MIM 168450) and PTH-related protein (PTHRP; MIM 168470) and is a ligand for PTH receptor-2 (PTHR2; MIM 601469) (John et al., 2002 [PubMed 11861531]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-35213
Species: Hu
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NBP1-40067
Species: Hu, Mu, Po, Bv, Ca, Eq, Mk, Pm
Applications: WB, ICC/IF, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-40364
Species: Hu
Applications: WB, IHC, IP
NBP1-88595
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85169
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46641
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP1-85734
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
AF1016
Species: Hu
Applications: WB, Neut
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-69679
Species: Hu
Applications: WB

Publications for Parathyroid hormone 2 Antibody (NBP1-69679) (0)

There are no publications for Parathyroid hormone 2 Antibody (NBP1-69679).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Parathyroid hormone 2 Antibody (NBP1-69679) (0)

There are no reviews for Parathyroid hormone 2 Antibody (NBP1-69679). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Parathyroid hormone 2 Antibody (NBP1-69679) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Parathyroid hormone 2 Products

Bioinformatics Tool for Parathyroid hormone 2 Antibody (NBP1-69679)

Discover related pathways, diseases and genes to Parathyroid hormone 2 Antibody (NBP1-69679). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Parathyroid hormone 2 Antibody (NBP1-69679)

Discover more about diseases related to Parathyroid hormone 2 Antibody (NBP1-69679).
 

Pathways for Parathyroid hormone 2 Antibody (NBP1-69679)

View related products by pathway.

PTMs for Parathyroid hormone 2 Antibody (NBP1-69679)

Learn more about PTMs related to Parathyroid hormone 2 Antibody (NBP1-69679).

Blogs on Parathyroid hormone 2

There are no specific blogs for Parathyroid hormone 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Parathyroid hormone 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTH2
Uniprot