Recombinant Human PAR1/Thrombin Receptor Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PAR1/Thrombin Receptor Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-61 of Human F2R partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT

Protein/Peptide Type
Partial Recombinant Protein
Gene
F2R

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PAR1/Thrombin Receptor Protein

  • Cf2r
  • CF2RHTR
  • coagulation factor II (thrombin) receptor
  • Coagulation factor II receptor
  • F2R
  • HTR
  • PAR1
  • PAR1PAR-1protease-activated receptor 1
  • Protease-Activated Receptor 1
  • Thrombin receptor
  • ThrR
  • TRGPC
  • TRproteinase-activated receptor 1

Background

Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009002-M01
Species: Hu
Applications: WB, ELISA
NBP1-87338
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS261
Species: Hu
Applications: WB (-), IHC-P, ICC
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
MAB3949
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-07799
Species: Hu
19540002
Species: Hu
Applications: ELISA, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2749
Species: Mu
Applications: WB, Flow, IP, CyTOF-ready, ICC

Publications for PAR1/Thrombin Receptor Partial Recombinant Protein (H00002149-Q01) (0)

There are no publications for PAR1/Thrombin Receptor Partial Recombinant Protein (H00002149-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAR1/Thrombin Receptor Partial Recombinant Protein (H00002149-Q01) (0)

There are no reviews for PAR1/Thrombin Receptor Partial Recombinant Protein (H00002149-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PAR1/Thrombin Receptor Partial Recombinant Protein (H00002149-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PAR1/Thrombin Receptor Products

Bioinformatics Tool for PAR1/Thrombin Receptor Partial Recombinant Protein (H00002149-Q01)

Discover related pathways, diseases and genes to PAR1/Thrombin Receptor Partial Recombinant Protein (H00002149-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAR1/Thrombin Receptor Partial Recombinant Protein (H00002149-Q01)

Discover more about diseases related to PAR1/Thrombin Receptor Partial Recombinant Protein (H00002149-Q01).
 

Pathways for PAR1/Thrombin Receptor Partial Recombinant Protein (H00002149-Q01)

View related products by pathway.

PTMs for PAR1/Thrombin Receptor Partial Recombinant Protein (H00002149-Q01)

Learn more about PTMs related to PAR1/Thrombin Receptor Partial Recombinant Protein (H00002149-Q01).
 

Research Areas for PAR1/Thrombin Receptor Partial Recombinant Protein (H00002149-Q01)

Find related products by research area.

Blogs on PAR1/Thrombin Receptor

There are no specific blogs for PAR1/Thrombin Receptor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PAR1/Thrombin Receptor Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol F2R
Entrez