We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PAQR8 Recombinant Protein Antigen

Images

 
There are currently no images for PAQR8 Recombinant Protein Antigen (NBP2-56507PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PAQR8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PAQR8.

Source: E. coli

Amino Acid Sequence: MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PAQR8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56507.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PAQR8 Recombinant Protein Antigen

  • C6orf33Lysosomal membrane protein in brain 1
  • LMPB1FLJ32521
  • lysosomal membrane protein in brain-1
  • membrane progestin receptor beta
  • mPR beta
  • MPRBFLJ46206
  • Progestin and adipoQ receptor family member 8
  • progestin and adipoQ receptor family member VIIIchromosome 6 open reading frame 33

Background

Progestin Receptor Beta-extra recognizes the extracellular epitope of the membrane progestin receptor. Progestin receptors with are found in pituitary, reproductive tract and most estrogen receptor-containing brain regions; these receptors are inducible by estrogen treatment. There are also progestin receptor sites in brain areas lacking estrogen receptors, such as the cerebral cortex of the rat; these receptors are not induced by estradiol treatment. Nevertheless, such receptors resemble those induced by estradiol. Another inducer of progestin receptors in brain is testosterone, which works through its conversion to estradiol via aromatization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83220
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, Simple Western, WB
NBP2-13731
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00054852-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
DRP300
Species: Hu
Applications: ELISA
739-G9
Species: Mu
Applications: BA
7754-BH/CF
Species: Hu
Applications: BA
202-IL
Species: Hu
Applications: BA
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
H00026135-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, WB
H00010424-M04
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, S-ELISA, WB
NBP2-38770
Species: Hu
Applications: WB
AF3709
Species: Hu
Applications: IHC, Simple Western, WB
DY1335B
Species: Hu
Applications: ELISA
AF2699
Species: Mu
Applications: Simple Western, WB
H00003814-M05
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00002729-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
5096-BM
Species: Hu
Applications: BA
AF4636
Species: Mu
Applications: WB
H00114327-D01P
Species: Hu, Mu
Applications: ICC/IF, WB

Publications for PAQR8 Recombinant Protein Antigen (NBP2-56507PEP) (0)

There are no publications for PAQR8 Recombinant Protein Antigen (NBP2-56507PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAQR8 Recombinant Protein Antigen (NBP2-56507PEP) (0)

There are no reviews for PAQR8 Recombinant Protein Antigen (NBP2-56507PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PAQR8 Recombinant Protein Antigen (NBP2-56507PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PAQR8 Products

Research Areas for PAQR8 Recombinant Protein Antigen (NBP2-56507PEP)

Find related products by research area.

Blogs on PAQR8

There are no specific blogs for PAQR8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PAQR8 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PAQR8