PAPD5 Antibody - BSA Free

Immunohistochemistry-Paraffin: PAPD5 Antibody [NBP2-48777] - Staining of human cervix, uterine shows moderate positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: PAPD5 Antibody [NBP2-48777] - Staining of human skeletal muscle shows no positivity in myocytes.

Immunohistochemistry-Paraffin: PAPD5 Antibody [NBP2-48777] - Staining of human endometrium shows moderate nuclear positivity.

Immunohistochemistry-Paraffin: PAPD5 Antibody [NBP2-48777] - Staining of human testis shows moderate positivity.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PAPD5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QSSSSDVDSDATPCKTPKQLLCRPSTGNRVGSQDVSLESSQAVGKMQSTQTTNTSNSTNKSQHGSARLFRSSSKGFQGTTQTSH
• Predicted Species: Mouse (90%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TENT4B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PAPD5 Recombinant Protein Antigen (NBP2-48777PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PAPD5 Antibody - BSA Free

• EC 2.7.7
• EC 2.7.7.-
• FLJ40270
• PAP associated domain containing 5
• Terminal uridylyltransferase 3
• Topoisomerase-related function protein 4-2
• TRF4-2PAP-associated domain-containing protein 5
• TUTase 3

Background

PAPD5 plays a role in replication-dependent histone mRNA degradation. May be involved in the terminal uridylationof mature histone mRNAs before their degradation is initiated. DNA polymerase, probably involved in DNA repair. Mayplay a role in sister chromatid c

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TENT4B