PAPD1 Antibody

Images

 
Immunohistochemistry-Paraffin: PAPD1 Antibody [NBP1-83856] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and Leydig cells).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PAPD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ETLELLLKEFFEYFGNFAFDKNSINIRQGREQNKPDSSPLYIQNPFETSLNISKNVSQSQLQKFVDLARESAWILQQEDTDRPSISSNRPWGLVSLLLPS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MTPAP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PAPD1 Protein (NBP1-83856PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PAPD1 Antibody

  • EC 2.7.7.19
  • FLJ10486
  • mitochondrial poly(A) polymerase
  • mtPAP
  • PAP associated domain containing 1
  • PAP
  • PAP-associated domain-containing protein 1
  • PAPD1SPAX4
  • poly(A) RNA polymerase, mitochondrial
  • Polynucleotide adenylyltransferase
  • Terminal uridylyltransferase 1
  • TUTase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-31564
Species: Hu
Applications: WB, IHC, IHC-P
NB110-57150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82485
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00064506-D01P
Species: Hu, Mu
Applications: WB, ELISA
NBP1-90111
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58551
Species: Hu
Applications: WB, ICC/IF
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-13729
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00056903-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-83856
Species: Hu
Applications: IHC, IHC-P

Publications for PAPD1 Antibody (NBP1-83856) (0)

There are no publications for PAPD1 Antibody (NBP1-83856).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAPD1 Antibody (NBP1-83856) (0)

There are no reviews for PAPD1 Antibody (NBP1-83856). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PAPD1 Antibody (NBP1-83856) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PAPD1 Products

Bioinformatics Tool for PAPD1 Antibody (NBP1-83856)

Discover related pathways, diseases and genes to PAPD1 Antibody (NBP1-83856). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAPD1 Antibody (NBP1-83856)

Discover more about diseases related to PAPD1 Antibody (NBP1-83856).
 

Pathways for PAPD1 Antibody (NBP1-83856)

View related products by pathway.

Blogs on PAPD1

There are no specific blogs for PAPD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAPD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MTPAP