Pannexin-1 Antibody

Images

 
Western Blot: Pannexin-1 Antibody [NBP1-59672] - Human Jurkat cell lysate Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry: Pannexin-1 Antibody [NBP1-59672] - Paraffin Embedded Tissue: Human neural cell Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X
Western Blot: Pannexin-1 Antibody [NBP1-59672] - Tissue: Hela whole cell lysates
Western Blot: Pannexin-1 Antibody [NBP1-59672] - PANX1 Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate
Western Blot: Pannexin-1 Antibody [NBP1-59672] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
Immunohistochemistry-Paraffin: Pannexin-1 Antibody [NBP1-59672] - Mouse Retina and Knockout PANX-1 Mouse Tissue.
Immunohistochemistry: Pannexin-1 Antibody [NBP1-59672] - Human Intestine

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Pannexin-1 Antibody Summary

Immunogen
Synthetic peptides corresponding to PANX1(pannexin 1) The peptide sequence was selected from the middle region of PANX1. Peptide sequence LGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVIN.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PANX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against PANX1 and was validated on Western Blot and immunohistochemistry-paraffin
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Pannexin-1 Antibody

  • Innexin
  • MGC21309
  • MRS1
  • MRS1innexin
  • pannexin 1
  • Pannexin1
  • Pannexin-1
  • PANX1
  • PX1
  • UNQ2529

Background

PANX1 belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 2 may form cell type-specific gap junctions with distinct properties.The protein encoded by this gene belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 2 may form cell type-specific gap junctions with distinct properties.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32470
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P
MAB7088
Species: Hu
Applications: WB
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
MAB8169
Species: Hu
Applications: WB
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-39032
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59672
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Pannexin-1 Antibody (NBP1-59672) (0)

There are no publications for Pannexin-1 Antibody (NBP1-59672).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pannexin-1 Antibody (NBP1-59672) (0)

There are no reviews for Pannexin-1 Antibody (NBP1-59672). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pannexin-1 Antibody (NBP1-59672) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Pannexin-1 Antibody (NBP1-59672)

Discover related pathways, diseases and genes to Pannexin-1 Antibody (NBP1-59672). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pannexin-1 Antibody (NBP1-59672)

Discover more about diseases related to Pannexin-1 Antibody (NBP1-59672).
 

Pathways for Pannexin-1 Antibody (NBP1-59672)

View related products by pathway.

PTMs for Pannexin-1 Antibody (NBP1-59672)

Learn more about PTMs related to Pannexin-1 Antibody (NBP1-59672).

Blogs on Pannexin-1

There are no specific blogs for Pannexin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pannexin-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PANX1
Entrez
Uniprot