Pancreatic Lipase Related Protein 2 Antibody

Images

 
Western Blot: Pancreatic Lipase Related Protein 2 Antibody [H00005408-B01P] - Analysis of PNLIPRP2 expression in transfected 293T cell line by PNLIPRP2 polyclonal antibody. Lane 1: PNLIPRP2 transfected lysate(51.59 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Pancreatic Lipase Related Protein 2 Antibody Summary

Immunogen
PNLIPRP2 (AAH05989.1, 1 a.a. - 469 a.a.) full-length human protein. MLPPWTLGLLLLATVRGKEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGGKEMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKRGINLSEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC
Specificity
PNLIPRP2 - pancreatic lipase-related protein 2,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PNLIPRP2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Pancreatic Lipase Related Protein 2 Antibody

  • EC 3.1.1
  • EC 3.1.1.3
  • galactolipase
  • pancreatic lipase-related protein 2
  • PL-RP2
  • PLRP2EC 3.1.1.26

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7105
Species: Hu
Applications: WB
NBP1-86109
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11664
Species: Hu
NBP2-46376
Species: Hu
Applications: WB, IHC
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-60930
Species: Hu, Mu
Applications: WB
NBL1-12547
Species: Hu
NBP1-83966
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-52932
Species: Hu
Applications: WB, IHC, IHC-P
MAB5018
Species: Hu
Applications: WB, IP
NBP1-47254
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-118
Species: Hu, Mu(-)
Applications: WB, ELISA, ICC/IF
H00005408-B01P
Species: Hu
Applications: WB

Publications for Pancreatic Lipase Related Protein 2 Antibody (H00005408-B01P) (0)

There are no publications for Pancreatic Lipase Related Protein 2 Antibody (H00005408-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pancreatic Lipase Related Protein 2 Antibody (H00005408-B01P) (0)

There are no reviews for Pancreatic Lipase Related Protein 2 Antibody (H00005408-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pancreatic Lipase Related Protein 2 Antibody (H00005408-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pancreatic Lipase Related Protein 2 Products

Bioinformatics Tool for Pancreatic Lipase Related Protein 2 Antibody (H00005408-B01P)

Discover related pathways, diseases and genes to Pancreatic Lipase Related Protein 2 Antibody (H00005408-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pancreatic Lipase Related Protein 2 Antibody (H00005408-B01P)

Discover more about diseases related to Pancreatic Lipase Related Protein 2 Antibody (H00005408-B01P).
 

Pathways for Pancreatic Lipase Related Protein 2 Antibody (H00005408-B01P)

View related products by pathway.

Research Areas for Pancreatic Lipase Related Protein 2 Antibody (H00005408-B01P)

Find related products by research area.

Blogs on Pancreatic Lipase Related Protein 2

There are no specific blogs for Pancreatic Lipase Related Protein 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pancreatic Lipase Related Protein 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PNLIPRP2
Entrez
Uniprot