Pancreatic Amylase Beta Antibody (2B12)

Images

 
ELISA: Pancreatic Amylase Beta Antibody (2B12) [H00000280-M01] - Detection limit for recombinant GST tagged AMY2B is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
2B12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Pancreatic Amylase Beta Antibody (2B12) Summary

Immunogen
AMY2B (NP_066188, 19 a.a. - 117 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHM
Specificity
AMY2B - amylase, alpha 2B; pancreatic (2B12)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AMY2B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Pancreatic Amylase Beta Antibody (2B12)

  • alpha-amylase 2B
  • AMY2
  • AMY2B amylase, alpha 2B (pancreatic)

Background

Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the pancreas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000276-M04
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89101
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4636
Species: Mu
Applications: WB
AF4317
Species: Hu
Applications: WB
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
AF4409
Species: Mu
Applications: WB
NBP1-89479
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32353
Species: Hu
Applications: WB, IHC, IHC-P
NB110-78644
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00000280-M01
Species: Hu
Applications: ELISA

Publications for Pancreatic Amylase Beta Antibody (H00000280-M01) (0)

There are no publications for Pancreatic Amylase Beta Antibody (H00000280-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pancreatic Amylase Beta Antibody (H00000280-M01) (0)

There are no reviews for Pancreatic Amylase Beta Antibody (H00000280-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Pancreatic Amylase Beta Antibody (H00000280-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pancreatic Amylase Beta Products

Bioinformatics Tool for Pancreatic Amylase Beta Antibody (H00000280-M01)

Discover related pathways, diseases and genes to Pancreatic Amylase Beta Antibody (H00000280-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pancreatic Amylase Beta Antibody (H00000280-M01)

Discover more about diseases related to Pancreatic Amylase Beta Antibody (H00000280-M01).
 

Pathways for Pancreatic Amylase Beta Antibody (H00000280-M01)

View related products by pathway.

Blogs on Pancreatic Amylase Beta

There are no specific blogs for Pancreatic Amylase Beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pancreatic Amylase Beta Antibody (2B12) and receive a gift card or discount.

Bioinformatics

Gene Symbol AMY2B
Entrez
Uniprot