pan PKC Antibody - BSA Free

Western Blot: pan PKC Antibody [NBP3-05673] - Analysis of extracts of various cell lines, using pan PKC antibody (NBP3-05673) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunocytochemistry/Immunofluorescence: pan PKC Antibody [NBP3-05673] - Immunofluorescence analysis of NIH-3T3 cells using pan PKC Rabbit pAb (NBP3-05673) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: pan PKC Antibody - BSA Free [pan PKC] - Immunofluorescence analysis of NIH-3T3 cells using pan PKC Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

pan PKC Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit pan PKC Antibody - BSA Free (NBP3-05673) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 572-672 of human PRKCA (NP_002728.2). MTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRKCA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for pan PKC Antibody - BSA Free

• AAG6;PKCA;PKCalpha;PKC-alpha;PKCI+/-;PRKACA;PRKCA;Protein kinase C;Protein kinase C alpha type

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRKCA