Pallidin Antibody [PE]

Product Discontinued

Pallidin Antibody [PE] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human Pallidin (NP_036520.1).
  
  Sequence:
  MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BLOC1S6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Alternate Names for Pallidin Antibody [PE]

• pallid (mouse) homolog, pallidin
• Pallid protein homolog
• PALLID
• pallidin homolog (mouse)
• pallidin
• PAsyntaxin 13 binding protein 1
• syntaxin 13-interacting protein pallid
• Syntaxin 13-interacting protein

Background

Pallidin, encoded by gene HGNC, may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BLOC1S6