PAK4 Antibody (3F10) - Azide and BSA Free

Western Blot: PAK4 Antibody (3F10) [H00010298-M01] - Detection against Immunogen (35.53 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3F10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PAK4 Antibody (3F10) - Azide and BSA Free Summary

• Immunogen: PAK4 (AAH02921, 68 a.a. ~ 157 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPEKPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLD
• Specificity: PAK4 - p21(CDKN1A)-activated kinase 4
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PAK4
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PAK4 Antibody (3F10) - Azide and BSA Free

• EC 2.7.11
• EC 2.7.11.1
• KIAA1142
• p21 protein (Cdc42/Rac)-activated kinase 4
• p21(CDKN1A)-activated kinase 4
• p21-activated kinase 4
• PAK4
• PAK-4
• protein kinase related to S. cerevisiae STE20, effector for Cdc42Hs
• serine/threonine-protein kinase PAK 4

Background

PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. PAK proteins are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. They serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK4 interacts specifically with the GTP-bound form of Cdc42Hs and weakly activates the JNK family of MAP kinases. PAK4 is a mediator of filopodia formation and may play a role in the reorganization of the actin cytoskeleton. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PAK4
• Entrez:
  • 10298(Human)
• OMIM:
  • 605451(Human)
• Uniprot:
  • AAH02921(Human)