PAGE4 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: PAGE4 Antibody [NBP1-85413] - Staining in human placenta and endometrium tissues using anti-PAGE4 antibody. Corresponding PAGE4 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: PAGE4 Antibody [NBP1-85413] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: PAGE4 Antibody [NBP1-85413] - Staining of human placenta shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

PAGE4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DSSSSVHDLLVAAMSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP
Specificity
Specificity of human PAGE4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAGE4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PAGE4 Protein (NBP1-85413PEP)
Publications
Read Publication using
NBP1-85413 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24708576).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PAGE4 Antibody

  • CT16.7
  • G antigen family C member 1
  • G antigen, family C, 1
  • GAGEC1GAGE-9
  • JM-27
  • P antigen family, member 4 (prostate associated)
  • PAGE-1
  • PAGE-4FLJ35184
  • Prostate-associated gene 4 protein
  • prostate-associated gene protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85414
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-47714
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
H00003641-P01
Species: Hu
NBP2-49659
Species: Hu
Applications: IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB300-229
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-62688
Species: Hu
Applications: IHC
MAB1144
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
NB600-507
Species: Hu, Mu, Rt, Rb
Applications: WB, PEP-ELISA
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45603
Species: Hu
Applications: WB, Flow, IHC
NBP1-84366
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85413
Species: Hu
Applications: IHC, IHC-P

Publications for PAGE4 Antibody (NBP1-85413)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PAGE4 Antibody (NBP1-85413) (0)

There are no reviews for PAGE4 Antibody (NBP1-85413). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PAGE4 Antibody (NBP1-85413) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PAGE4 Products

Bioinformatics Tool for PAGE4 Antibody (NBP1-85413)

Discover related pathways, diseases and genes to PAGE4 Antibody (NBP1-85413). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAGE4 Antibody (NBP1-85413)

Discover more about diseases related to PAGE4 Antibody (NBP1-85413).
 

Pathways for PAGE4 Antibody (NBP1-85413)

View related products by pathway.

PTMs for PAGE4 Antibody (NBP1-85413)

Learn more about PTMs related to PAGE4 Antibody (NBP1-85413).
 

Research Areas for PAGE4 Antibody (NBP1-85413)

Find related products by research area.

Blogs on PAGE4

There are no specific blogs for PAGE4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAGE4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAGE4
Entrez
Uniprot