PAGE4 Antibody - BSA Free

Immunohistochemistry-Paraffin: PAGE4 Antibody [NBP1-85413] - Staining in human placenta and endometrium tissues using anti-PAGE4 antibody. Corresponding PAGE4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PAGE4 Antibody [NBP1-85413] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: PAGE4 Antibody [NBP1-85413] - Staining of human placenta shows high expression.

Immunohistochemistry of candidate biomarkers in prostate cancer. Representative immunohistochemical staining of ACPP, ADAM9, ALDH1A2, CASR, CCND1, CCPG1, CD34, CD44, CD44v6, CHGA, CHMP1A, EI24, ENO2, GADD45B, HA, HAS2, HES6, HMMR, HOXC6, HYAL1, IGF1, IQCK, MAP4K4, MKI67, PAGE4, PLIN2, PTEN, SIAH2, SMAD4, SOX9, SPP1, SYP, & TP53 from prostate cancer tissue microarrays. Scale bar represents 50 μm. Image collected & cropped by CiteAb from the following publication (//bmccancer.biomedcentral.com/articles/10.1186/1471-2407-14-244), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

ChIP-Exo-Seq composite graph for Anti-PAGE4 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PAGE4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DSSSSVHDLLVAAMSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PAGE4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: IHC reported in scientific literature (PMID: 24708576). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PAGE4 Protein (NBP1-85413PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24708576).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PAGE4 Antibody - BSA Free

• CT16.7
• G antigen family C member 1
• G antigen, family C, 1
• GAGEC1GAGE-9
• JM-27
• P antigen family, member 4 (prostate associated)
• PAGE-1
• PAGE-4FLJ35184
• Prostate-associated gene 4 protein
• prostate-associated gene protein 4

Background

PAGE4 is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PAGE4 Antibody (NBP1-85413)(1)

Publication using NBP1-85413

• Rizzardi AE, Rosener NK, Koopmeiners JS et al. Evaluation of protein biomarkers of prostate cancer aggressiveness. BMC Cancer 2014-04-05 [PMID: 24708576] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: PAGE4
• Entrez:
  • 9506(Human)
• Uniprot:
  • O60829(Human)