PAGE4 Antibody

Images

 
Western Blot: PAGE4 Antibody [H00009506-B01P] - Analysis of PAGE4 expression in transfected 293T cell line by PAGE4 polyclonal antibody. Lane 1: PAGE4 transfected lysate(11.22 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PAGE4 Antibody Summary

Immunogen
PAGE4 (NP_008934.1, 1 a.a. - 102 a.a.) full-length human protein. MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP
Specificity
PAGE4 - P antigen family, member 4 (prostate associated),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PAGE4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PAGE4 Antibody

  • CT16.7
  • G antigen family C member 1
  • G antigen, family C, 1
  • GAGEC1GAGE-9
  • JM-27
  • P antigen family, member 4 (prostate associated)
  • PAGE-1
  • PAGE-4FLJ35184
  • Prostate-associated gene 4 protein
  • prostate-associated gene protein 4

Background

This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85414
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47714
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-49659
Species: Hu
Applications: IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB300-229
Species: Mu, Rt, Ch, Ma, Pm, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-62688
Species: Hu
Applications: IHC, IHC-P
MAB1144
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB600-507
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, PEP-ELISA, KD
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84366
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PAGE4 Antibody (H00009506-B01P) (0)

There are no publications for PAGE4 Antibody (H00009506-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAGE4 Antibody (H00009506-B01P) (0)

There are no reviews for PAGE4 Antibody (H00009506-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PAGE4 Antibody (H00009506-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PAGE4 Products

Bioinformatics Tool for PAGE4 Antibody (H00009506-B01P)

Discover related pathways, diseases and genes to PAGE4 Antibody (H00009506-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAGE4 Antibody (H00009506-B01P)

Discover more about diseases related to PAGE4 Antibody (H00009506-B01P).
 

Pathways for PAGE4 Antibody (H00009506-B01P)

View related products by pathway.

PTMs for PAGE4 Antibody (H00009506-B01P)

Learn more about PTMs related to PAGE4 Antibody (H00009506-B01P).
 

Research Areas for PAGE4 Antibody (H00009506-B01P)

Find related products by research area.

Blogs on PAGE4

There are no specific blogs for PAGE4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAGE4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAGE4
Entrez
Uniprot