PAFAH1B3 Antibody (8C11)

Images

 
Western Blot: PAFAH1B3 Antibody (8C11) [H00005050-M02] - PAFAH1B3 monoclonal antibody (M02), clone 8C11 Analysis of PAFAH1B3 expression in IMR-32.
Immunocytochemistry/ Immunofluorescence: PAFAH1B3 Antibody (8C11) [H00005050-M02] - Analysis of monoclonal antibody to PAFAH1B3 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: PAFAH1B3 Antibody (8C11) [H00005050-M02] - PAFAH1B3 monoclonal antibody (M02), clone 8C11. Analysis of PAFAH1B3 expression in PC-12.
Western Blot: PAFAH1B3 Antibody (8C11) [H00005050-M02] - PAFAH1B3 monoclonal antibody (M02), clone 8C11. Analysis of PAFAH1B3 expression in Jurkat.
Sandwich ELISA: PAFAH1B3 Antibody (8C11) [H00005050-M02] - Detection limit for recombinant GST tagged PAFAH1B3 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
8C11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PAFAH1B3 Antibody (8C11) Summary

Immunogen
PAFAH1B3 (AAH03016, 1 a.a. - 231 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGAPLLEPAP
Specificity
PAFAH1B3 - platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PAFAH1B3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Publications
Read Publication using H00005050-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PAFAH1B3 Antibody (8C11)

  • EC 3.1.1.47
  • FLJ44990
  • PAF acetylhydrolase 29 kDa subunit
  • PAF-AH 29 kDa subunit
  • PAFAH subunit gamma
  • PAF-AH subunit gamma
  • PAF-AH1b alpha 1 subunit
  • PAFAHG
  • platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa)
  • platelet-activating factor acetylhydrolase IB subunit gamma
  • platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit (29kD)
  • platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa
  • platelet-activating factor acetylhydrolase, isoform Ib, subunit 3 (29kDa)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13725
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-1081
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-78162
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16095
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83002
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP1-81761
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81788
Species: Hu
Applications: IHC, IHC-P
NBP1-88899
Species: Hu
Applications: IHC, IHC-P
NBP1-84416
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37573
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, IHC
NB100-2216
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, PAGE
NBP1-81687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-48308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF

Publications for PAFAH1B3 Antibody (H00005050-M02)(1)

Reviews for PAFAH1B3 Antibody (H00005050-M02) (0)

There are no reviews for PAFAH1B3 Antibody (H00005050-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PAFAH1B3 Antibody (H00005050-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PAFAH1B3 Products

Bioinformatics Tool for PAFAH1B3 Antibody (H00005050-M02)

Discover related pathways, diseases and genes to PAFAH1B3 Antibody (H00005050-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAFAH1B3 Antibody (H00005050-M02)

Discover more about diseases related to PAFAH1B3 Antibody (H00005050-M02).
 

Pathways for PAFAH1B3 Antibody (H00005050-M02)

View related products by pathway.

PTMs for PAFAH1B3 Antibody (H00005050-M02)

Learn more about PTMs related to PAFAH1B3 Antibody (H00005050-M02).
 

Research Areas for PAFAH1B3 Antibody (H00005050-M02)

Find related products by research area.

Blogs on PAFAH1B3

There are no specific blogs for PAFAH1B3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAFAH1B3 Antibody (8C11) and receive a gift card or discount.

Bioinformatics

Gene Symbol PAFAH1B3
Entrez
OMIM
Uniprot